Xanthomonas axonopodis pv. citri str. 306

  1. XAC4372NP_644666.1putative inner membrane protein translocase component YidC

XAC4372
XAC4371
XAC4371
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC4373
XAC4373
ID
AC NP_644666.1
LT XAC4372
SY
OR NC_003919 from 5172987 to 5174711 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE putative inner membrane protein translocase component YidC
IP 60 kDa inner membrane insertion protein
CL
EC
GO Biological Process: protein insertion into membrane (GO:0051205)
Cellular Component: integral to membrane (GO:0016021)
PM
AN
SQ 574 aa
 
........10........20........30........40........50
| | | | |
MNQTRVFLIFAWLMVAALLWMEWGKDKAAANAPVVAATQSVPAARDLDAA
TPSAANVPAAQAIPQAGAPGAVPATSTTAATPAAAGAAPVVTLTSDVLRL
KLDGRSVLDAELLQFPQTKDGTAPVSLLTEDPAHPYNATSGWASEHSPVP
GVGGFRAEQPGTTFDMAKGQNTLVVPFVWNGPDGVSIRRTFTLERGRYAI
SIKDEVINKSGAPWNGYVFRKLSRVPTILSRGMTNPDSFSFNGATWYSPQ
EGYERRAFKDYMDDGGLNRQITGGWVALLQHHFFTAWIPQKDQASLYVLA
QDGPRDVAELRGPAFTVAPGQTASTEARLWVGPKLVSLIAKEDVKGLDRV
VDYSRFSIMAIIGQGLFWVLSHLHSFLHNWGWAIIGLVVLLRLALYPLSA
AQYKSGAKMRRFQPRLAQLKERYGDDRVKYQQATMELFKKEKINPMGGCL
PLLIQMPIFFALYWVLVESVELRQAPWLGWIQDLTARDPYFILPLLNISI
MWATQKLTPTPGMDPMQAKMMQFMPLVFGVMMAFMPAGLVLYWVVNGGLG
LLIQWWMIRQHGEKPSKIIQANAK
Hamap OXAA_MF_01810 raw_score=4461 norm_score=17.785

Membrane protein oxaA [oxaA].

pubmed

1

574

S=2477 I=84 E=0

Inner membrane protein oxaA ; Cell Transmembrane

Pubmed 12039751

 

prodomImg

pubmed

93

560

S=903 I=41 E=1.86416e-100

Inner membrane protein oxaA ; Cell Transmembrane

Pubmed 1552862

 

prodomImg

pubmed

93

564

S=813 I=39 E=1.21546e-89

Inner membrane protein oxaA ; Cell Transmembrane

Pubmed 7686882

 

prodomImg

pubmed

95

561

S=808 I=37 E=4.99064e-89

Inner membrane protein oxaA ; Cell Transmembrane

Pubmed 8071197

 

prodomImg

pubmed

93

555

S=698 I=35 E=1.15009e-75

Inner membrane protein oxaA ; Cell Transmembrane

Pubmed 17303757

 

prodomImg

pubmed

95

555

S=686 I=35 E=3.79421e-74

Inner membrane protein oxaA ; Cell Transmembrane

Pubmed 17493812

 

prodomImg

pubmed

93

558

S=651 I=31 E=6.27029e-70

Membrane protein oxaA ; Cell Transmembrane

Pubmed 9516544

 

prodomImg

pubmed

175

557

S=479 I=30 E=4.42368e-49

Inner membrane protein oxaA ; Cell Transmembrane

Pubmed 18025092

 

prodomImg

pubmed

175

557

S=476 I=30 E=9.44517e-49

Inner membrane protein oxaA ; Cell Transmembrane

Pubmed 17916642

 

prodomImg

pubmed

326

554

S=451 I=38 E=9.50404e-46

Membrane protein oxaA ; Cell Transmembrane

Pubmed 9420234

 

prodomImg

sp

1

574

S=2513 I=84 E=0

Inner membrane protein oxaA - Xanthomonas oryzae pv. oryzae

 

prodomImg

sp

1

574

S=2491 I=83 E=0

Inner membrane protein oxaA - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

sp

1

574

S=2477 I=84 E=0

Inner membrane protein oxaA - Xanthomonas campestris pv. campestris

Pubmed 12039751,

 

prodomImg

sp

1

574

S=2475 I=84 E=0

Inner membrane protein oxaA - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

sp

93

574

S=2457 I=96 E=0

Inner membrane protein oxaA - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

574

S=2513 I=84 E=0

60 kDa inner-membrane protein - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

trembl

1

574

S=2479 I=84 E=0

Inner membrane insertion protein - Xanthomonas campestris pv. campestris (strain B100)

 

prodomImg

trembl

93

574

S=1926 I=73 E=0

60 kDa inner membrane insertion protein - Xylella fastidiosa (strain M23)

 

prodomImg

Iprscan IPR001708 [PR00701]

184

204

60 kDa inner membrane insertion protein

Iprscan IPR001708 [PR00701]

2

23

60 kDa inner membrane insertion protein

Iprscan IPR001708 [PR00701]

240

258

60 kDa inner membrane insertion protein

Iprscan IPR001708 [PR00701]

274

289

60 kDa inner membrane insertion protein

Iprscan IPR001708 [PR00701]

441

464

60 kDa inner membrane insertion protein

Iprscan IPR001708 [PR00701]

488

510

60 kDa inner membrane insertion protein

Iprscan IPR001708 [PR00701]

525

548

60 kDa inner membrane insertion protein

Iprscan IPR013308 [PR01900]

365

381

YidC translocase/secretase

Iprscan IPR013308 [PR01900]

494

509

YidC translocase/secretase

Iprscan IPR013308 [PR01900]

514

538

YidC translocase/secretase

Iprscan IPR001708 [PTHR12428]

374

568

60 kDa inner membrane insertion protein

Iprscan [PTHR12428:SF11]

374

568

-

Iprscan IPR001708 [PF02096]

378

562

60 kDa inner membrane insertion protein

Iprscan [SignalP-NN(euk)]

1

17

-

Iprscan [tmhmm]

379

401

-

Iprscan [tmhmm]

445

467

-

Iprscan [tmhmm]

523

545

-

Iprscan [tmhmm]

7

24

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one iYErdXIH)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits