Xanthomonas axonopodis pv. citri str. 306

  1. XAC4349NP_644643.1alginate lyase

XAC4349
XAC4348
XAC4348
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC4350
XAC4350
ID
AC NP_644643.1
LT XAC4349
SY
OR NC_003919 from 5142252 to 5143259 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE alginate lyase
IP Alcohol dehydrogenase superfamily, zinc-containing; NAD(P)-binding
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: binding (GO:0005488)
Molecular Function: oxidoreductase activity (GO:0016491)
PM
AN
SQ 335 aa
 
........10........20........30........40........50
| | | | |
MKAIAYLQHGLPIDDARALVELELPLPTPGPRDLRVRIHAVSVNPVDTKV
RSNAAVDAPRVLGWDASGVVDAVGEAVSLFRPGDAVYYAGALTRPGTNAE
FHLVDERLVGRKPATLDDAAAAALPLTAITAWELLFDRLGVAEGGGEGQA
LLVVGAAGGVGSMLVQLARTLTKLTVIGTASRPETQDWVHALGAHHVIDH
SQPLSEGLQRIGIAQVQHVASLTHTDQHFAQLVEVLAPQGQLALIDDPAT
LDALPLKRKSLSLHWELMFTRSLFETEDMIAQHHLLNRVAELVDTGVLRT
TLGEHYGRITADNLRRAHAALESHRTRGKLVLEGF
xansp

NP_641358.1 lcl|XAC1011-XAC1011

1

335

S=702 I=46 E=1.56616e-78

oxidoreductase

pubmed

1

335

S=763 I=48 E=7.86887e-84

Putative zinc-binding dehydrogenase

Pubmed 15574953

 

prodomImg

pubmed

1

332

S=446 I=32 E=2.20843e-45

Zinc-type alcohol dehydrogenase-like protein SA1988 ; Metal-binding Oxidoreductase

Pubmed 15590099

 

prodomImg

pubmed

19

333

S=205 I=29 E=2.92479e-16

Putative oxidoreductase

Pubmed 10627032

 

prodomImg

pubmed

23

332

S=192 I=26 E=1.18949e-14

Predicted zinc-binding oxidoreductase

Pubmed 9434161,10094695

 

prodomImg

pubmed

1

255

S=157 I=24 E=2.26001e-10

Zeta-crystallin

Pubmed 11371565

 

prodomImg

pubmed

1

103

S=145 I=37 E=6.31764e-09

Zeta-crystallin

Pubmed 16978188

 

prodomImg

pubmed

1

109

S=140 I=33 E=2.27599e-08

Zeta-crystallin ; Cytoplasm DNA-binding

Pubmed 9154917

 

prodomImg

pubmed

1

200

S=139 I=26 E=3.55044e-08

Quinone oxidoreductase EC=1.6.5.5 ; Cytoplasm Eye lens protein NADP

Pubmed 2777081,1420281

 

prodomImg

pubmed

23

205

S=136 I=25 E=8.63985e-08

Quinone oxidoreductase EC=1.6.5.5 ; Cytoplasm NADP

Pubmed 7476124

 

prodomImg

pubmed

23

107

S=135 I=36 E=1.04667e-07

NADPH:quinone reductase-like protein

Pubmed 17086451

 

prodomImg

sp

1

332

S=456 I=32 E=9.32079e-47

Zinc-type alcohol dehydrogenase-like protein SERP1785 - Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

 

prodomImg

sp

1

332

S=451 I=31 E=3.38731e-46

Zinc-type alcohol dehydrogenase-like protein SE_1777 - Staphylococcus epidermidis (strain ATCC 12228)

 

prodomImg

sp

1

332

S=449 I=32 E=5.97005e-46

Zinc-type alcohol dehydrogenase-like protein SAR2277 - Staphylococcus aureus (strain MRSA252)

 

prodomImg

sp

1

332

S=448 I=32 E=6.62852e-46

Zinc-type alcohol dehydrogenase-like protein MW2112 - Staphylococcus aureus (strain MW2)

 

prodomImg

sp

1

332

S=448 I=32 E=6.62852e-46

Zinc-type alcohol dehydrogenase-like protein SAS2087 - Staphylococcus aureus (strain MSSA476)

 

prodomImg

trembl

1

335

S=1441 I=85 E=3.91454e-165

Putative oxidoreductase - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

335

S=1351 I=79 E=3.6491e-154

Putative oxidoreductase - Xanthomonas campestris pv. campestris (strain B100)

 

prodomImg

trembl

1

335

S=1348 I=79 E=7.33003e-154

Bifunctional oxidoreductase/alginate lyase - Xanthomonas campestris pv. campestris

 

prodomImg

Iprscan [G3DSA:3.90.180.10]

1

156

-

Iprscan IPR002085 [PTHR11695]

18

333

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan [PTHR11695:SF34]

18

333

-

Iprscan IPR013149 [PF00107]

147

285

Alcohol dehydrogenase, zinc-binding

Iprscan IPR013154 [PF08240]

31

112

Alcohol dehydrogenase GroES-like

Iprscan IPR014182 [TIGR02817]

2

335

Alcohol dehydrogenase, zinc-binding type 1

Iprscan IPR002364 [PS01162]

148

169

Quinone oxidoreductase/zeta-crystallin, conserved site

Iprscan IPR011032 [SSF50129]

1

144

GroES-like

Iprscan IPR016040 [SSF51735]

120

300

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 4MvVjmyu)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits