Xanthomonas axonopodis pv. citri str. 306

  1. XAC4098NP_644397.1dehydratase

XAC4098
XAC4097
XAC4097
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC4099
XAC4099
ID
AC NP_644397.1
LT XAC4098
SY
OR NC_003919 from 4801781 to 4802068 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE dehydratase
IP
CL
EC
GO
PM
AN
SQ 95 aa
 
........10........20........30........40........50
| | | | |
MDFVVPHDHPCLPGHFPGRPVVPGVVVLDHVLQAVEALHGPRAAMRLPQV
KFVQPLLPGQTASVTLEGDGPRWRFRVQRAEALLVSGELVAEAAP
pubmed

1

94

S=362 I=79 E=3.86676e-36

Putative dehydratase

Pubmed 12057948

 

prodomImg

trembl

1

94

S=382 I=84 E=1.03033e-37

Xanthomonadine biosynthesis acyl carrier protein dehydratase - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

94

S=367 I=79 E=7.00882e-36

Putative dehydratase - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

94

S=362 I=79 E=3.13996e-35

Putative dehydratase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one JUx2W2vQ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits