Xanthomonas axonopodis pv. citri str. 306

  1. XAC4072trxANP_644371.1thioredoxin

trxA XAC4072
XAC4071
XAC4071
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC4073
XAC4073
ID trxA
AC NP_644371.1
LT XAC4072
SY
OR NC_003919 from 4767863 to 4768189 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE thioredoxin
IP Thioredoxin-like fold; Thioredoxin, core; Protein disulphide-isomerase A4
CL
EC
GO Biological Process: cell redox homeostasis (GO:0045454)
PM
AN
SQ 108 aa
 
........10........20........30........40........50
| | | | |
MQTITVTSPEHYTQTLAAHPRALVDFYKDNCPGCRMLDMSLDKFANSDAA
NGVALLKVKLEVVGEDFFRDLGLRQTPTLALYRDGAEVARLPGFQSPAQV
EAAVRSGL
pubmed

1

97

S=184 I=36 E=1.16748e-14

Gp60

Pubmed 16188359

 

prodomImg

pubmed

1

105

S=184 I=34 E=1.16748e-14

Gp128

Pubmed 18567664

 

prodomImg

pubmed

3

102

S=119 I=32 E=1.05365e-06

Thioredoxin ; Electron transport Redox-active center

Pubmed 9359865,10632710

 

prodomImg

pubmed

11

101

S=118 I=26 E=1.41723e-06

Disulfide bond formation protein A ; Oxidoreductase Redox-active center Secreted Signal

Pubmed 10376821

 

prodomImg

pubmed

11

101

S=118 I=26 E=1.41723e-06

SPBc2 prophage-derived disulfide bond formation protein A ; Oxidoreductase Redox-active center Secreted Signal

Pubmed 10455116

 

prodomImg

pubmed

6

104

S=116 I=21 E=2.21081e-06

Thioredoxin

Pubmed 17182577

 

prodomImg

pubmed

3

98

S=110 I=29 E=1.23166e-05

Thioredoxin ; Electron transport Redox-active center

Pubmed 9795994

 

prodomImg

pubmed

3

93

S=109 I=27 E=1.42844e-05

Thioredoxin C-1 ; Electron transport Redox-active center

Pubmed 7021558

 

prodomImg

pubmed

8

108

S=106 I=32 E=3.35692e-05

Thioredoxin-2 ; Cytoplasm Deoxyribonucleotide synthesis Electron transport Golgi apparatus Membrane Nucleus Phosphoprotein Redox-active center

Pubmed 1988444,2026619

 

prodomImg

sp

8

100

S=120 I=28 E=4.71538e-07

Thioredoxin - Treponema pallidum

 

prodomImg

sp

5

108

S=119 I=23 E=5.8129e-07

Thioredoxin - Coprinus comatus (Shaggy mane)

 

prodomImg

sp

3

102

S=119 I=32 E=7.042e-07

Thioredoxin - Alicyclobacillus acidocaldarius (Bacillus acidocaldarius)

Pubmed 9359865,10632710,12837806,

 

prodomImg

sp

11

101

S=118 I=26 E=9.4719e-07

Disulfide bond formation protein A precursor - Bacteriophage SPBc2

Pubmed 10376821,

 

prodomImg

sp

11

101

S=118 I=26 E=9.4719e-07

SPBc2 prophage-derived disulfide bond formation protein A precursor - Bacillus subtilis

Pubmed 10455116,11872755,

 

prodomImg

trembl

1

108

S=522 I=89 E=1.22534e-54

Thioredoxin - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

1

108

S=522 I=89 E=1.22534e-54

Thioredoxin - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

trembl

1

108

S=522 I=89 E=1.22534e-54

Putative thioredoxin - Xanthomonas campestris pv. campestris (strain B100)

 

prodomImg

Iprscan IPR012335 [G3DSA:3.40.30.10]

3

103

Thioredoxin fold

Iprscan IPR015467 [PTHR10438]

12

108

Thioredoxin, core

Iprscan IPR013766 [PF00085]

3

107

Thioredoxin domain

Iprscan IPR017936 [PS51352]

1

108

Thioredoxin-like

Iprscan IPR012336 [SSF52833]

3

106

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one IrRM27Hi)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits