Xanthomonas axonopodis pv. citri str. 306

  1. XAC4052NP_644351.1TonB-like protein

XAC4052
XAC4051
XAC4051
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC4053
XAC4053
ID
AC NP_644351.1
LT XAC4052
SY
OR NC_003919 from 4747404 to 4748414 on strand +
OS Xanthomonas axonopodis pv. citri str. 306
DE TonB-like protein
IP Gram-negative bacterial tonB protein
CL
EC
GO Biological Process: protein transport (GO:0015031)
Biological Process: iron ion transport (GO:0006826)
Cellular Component: membrane (GO:0016020)
Cellular Component: outer membrane-bounded periplasmic space (GO:0030288)
Molecular Function: iron ion transmembrane transporter activity (GO:0005381)
Molecular Function: protein transporter activity (GO:0008565)
PM
AN
SQ 336 aa
 
........10........20........30........40........50
| | | | |
MLDLTQGRMARRIAPVILLVGLVACSKQEDKAATTTPATGATPAATAPTP
ATAVSPQVQSMAAEQLRESATKALQDNRMYAPAGDNAVEYYLALREKQPQ
DATVNSALTDLLPYTLIAAEQGISREEFPEAQRLIALIEKVDPQAPALPR
LKSGLETGMKTAANRSEQDAEQAKKQVEDKAKQAAEQKRLAEQQSREAAA
AQQIAAQQEAARQQTAEAERQAAARRQAEAPAPTPAAPRPAPAAAAAAAP
AAQSLRPISTPAPRYPAEALRSGTSGEVLVELTVGTDGSITASRVLRANP
PRVFDREALNAVKRWRFEPVAAPVTTRRTLSFNPGD
xansp

NP_643083.1 lcl|XAC2774-XAC2774

255

319

S=127 I=45 E=7.84637e-09

TonB-like protein

xansp

NP_640364.1 lcl|tonB-XAC0008

263

318

S=114 I=36 E=2.56609e-07

TonB protein

xansp

NP_643669.1 lcl|XAC3362-XAC3362

263

319

S=114 I=37 E=3.10867e-07

TonB-like protein

pubmed

254

319

S=149 I=41 E=2.26757e-09

TonB-like protein

Pubmed 18324396

 

prodomImg

pubmed

257

319

S=145 I=40 E=6.74331e-09

TonB2

Pubmed 15557661

 

prodomImg

pubmed

257

318

S=139 I=39 E=3.26761e-08

TonB2 protein

Pubmed 15689115

 

prodomImg

pubmed

256

322

S=136 I=40 E=7.54632e-08

Protein tonB ; Cell inner membrane Periplasm transport Repeat Signal-anchor Transmembrane

Pubmed 8384290

 

prodomImg

pubmed

255

319

S=131 I=42 E=3.56232e-07

Protein tonB ; Cell inner membrane Periplasm transport Repeat Transmembrane

Pubmed 8704984

 

prodomImg

pubmed

256

319

S=125 I=41 E=1.71121e-06

Protein tonB ; Bacteriocin transport Cell inner membrane Periplasm Phage recognition Repeat Signal-anchor Transmembrane

Pubmed 6310567

 

prodomImg

pubmed

256

318

S=124 I=38 E=2.42529e-06

Protein tonB ; Bacteriocin transport Cell inner membrane Periplasm Phage recognition Repeat Signal-anchor Transmembrane

Pubmed 1838128

 

prodomImg

pubmed

263

318

S=116 I=36 E=1.78597e-05

TonB

Pubmed 12646254

 

prodomImg

pubmed

263

318

S=116 I=36 E=1.78597e-05

Protein tonB ; Cell inner membrane Periplasm transport Repeat Signal-anchor Transmembrane

Pubmed 9371459,18304669

 

prodomImg

pubmed

258

319

S=115 I=40 E=2.73787e-05

Protein tonB2 ; Cell inner membrane Periplasm transport Transmembrane

Pubmed 10689178

 

prodomImg

sp

256

322

S=136 I=40 E=4.75232e-08

Protein tonB - Yersinia enterocolitica

Pubmed 8384290,

 

prodomImg

sp

255

319

S=131 I=42 E=2.24338e-07

Protein tonB - Pseudomonas aeruginosa

Pubmed 8704984,

 

prodomImg

sp

256

319

S=125 I=41 E=1.07764e-06

Protein tonB - Escherichia coli (strain K12)

Pubmed 6310567,1885532,8316087,11328822,

 

prodomImg

sp

256

318

S=124 I=38 E=1.52733e-06

Protein tonB - Serratia marcescens

Pubmed 1838128,

 

prodomImg

sp

263

318

S=116 I=36 E=1.12472e-05

Protein tonB - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

1

190

S=824 I=88 E=2.49452e-90

Putative uncharacterized protein - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

254

336

S=445 I=100 E=1.99889e-44

Putative uncharacterized protein - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

190

S=782 I=84 E=3.37056e-85

TonB-like protein - Xanthomonas campestris pv. campestris

 

prodomImg

Iprscan IPR003538 [PR01374]

257

278

Gram-negative bacterial tonB protein

Iprscan IPR003538 [PR01374]

278

296

Gram-negative bacterial tonB protein

Iprscan IPR003538 [PR01374]

297

314

Gram-negative bacterial tonB protein

Iprscan IPR003538 [PF03544]

262

296

Gram-negative bacterial tonB protein

Iprscan IPR006260 [TIGR01352]

263

335

TonB, C-terminal

Iprscan [SignalP-NN(euk)]

1

25

-

Iprscan [SSF74653]

228

336

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one xGYG9CFz)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits