Xanthomonas axonopodis pv. citri str. 306

  1. XAC3830trxANP_644136.1thioredoxin

trxA XAC3830
XAC3829
XAC3829
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC3831
XAC3831
ID trxA
AC NP_644136.1
LT XAC3830
SY
OR NC_003919 from 4504283 to 4504624 on strand +
OS Xanthomonas axonopodis pv. citri str. 306
DE thioredoxin
IP Thioredoxin; Thioredoxin-like fold
CL
EC
GO Biological Process: cell redox homeostasis (GO:0045454)
Biological Process: glycerol ether metabolic process (GO:0006662)
Molecular Function: protein disulfide oxidoreductase activity (GO:0015035)
Molecular Function: electron carrier activity (GO:0009055)
PM
AN
SQ 113 aa
 
........10........20........30........40........50
| | | | |
MSDKVQHVGDADFDTAVLQAGEPVLVDFWAEWCGPCKMIAPVLDDLADTY
QGRLKVAKVNVDQNRALAIKYHVRSIPMLLLFKDGQVQATQIGAVGKGQL
TQMIDKTLGGAAA
xansp

NP_643092.1 lcl|trx-XAC2783

1

104

S=235 I=44 E=1.24808e-22

thioredoxin

xansp

NP_641612.1 lcl|trx-XAC1277

11

109

S=195 I=37 E=8.61782e-18

thioredoxin

xansp

NP_640465.1 lcl|trxA-XAC0109

19

86

S=91 I=34 E=3.62748e-05

thioredoxin

pubmed

1

108

S=376 I=62 E=8.33549e-38

Thioredoxin-1 ; Electron transport Redox-active center

Pubmed 1561103,8253691

 

prodomImg

pubmed

1

108

S=376 I=62 E=8.33549e-38

Thioredoxin-1 ; Electron transport Host-virus interaction Redox-active center

Pubmed 6098320,6099324

 

prodomImg

pubmed

1

108

S=351 I=56 E=7.95995e-35

Thioredoxin ; Electron transport Redox-active center

Pubmed 7496529

 

prodomImg

pubmed

2

108

S=346 I=55 E=3.04812e-34

Thioredoxin

Pubmed 17294328

 

prodomImg

pubmed

1

108

S=346 I=57 E=3.66057e-34

Thioredoxin ; Electron transport Redox-active center

Pubmed 10224002

 

prodomImg

pubmed

2

107

S=321 I=52 E=4.01895e-31

Thioredoxin ; Electron transport Redox-active center

Pubmed 3567166

 

prodomImg

pubmed

7

104

S=312 I=55 E=4.19452e-30

Thioredoxin C-1 ; Electron transport Redox-active center

Pubmed 7021558

 

prodomImg

pubmed

1

108

S=310 I=47 E=7.39273e-30

Thioredoxin

Pubmed 11976137

 

prodomImg

pubmed

4

109

S=301 I=49 E=9.84911e-29

Thioredoxin M-type, chloroplastic ; Electron transport Plastid Redox-active center Transit peptide

Pubmed 1536927,3510868

 

prodomImg

pubmed

8

108

S=300 I=53 E=1.4329e-28

Thioredoxin-1 ; Electron transport Redox-active center

Pubmed 2492995

 

prodomImg

sp

1

108

S=376 I=62 E=5.51511e-38

Thioredoxin-1 - Shigella flexneri

 

prodomImg

sp

1

108

S=376 I=62 E=5.51511e-38

Thioredoxin-1 - Salmonella typhimurium

Pubmed 1561103,8253691,

 

prodomImg

sp

1

108

S=376 I=62 E=5.51511e-38

Thioredoxin-1 - Salmonella typhi

 

prodomImg

sp

1

108

S=376 I=62 E=5.51511e-38

Thioredoxin-1 - Escherichia coli (strain K12)

Pubmed 6098320,6099324,3891733,1379743,4883076,1094461,4616096,2181145,8098620,10489448,10947986,2193685,7812718,

 

prodomImg

sp

1

108

S=376 I=62 E=5.51511e-38

Thioredoxin-1 - Escherichia coli O6

 

prodomImg

trembl

1

113

S=586 I=99 E=2.20408e-62

Thioredoxin - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

113

S=576 I=96 E=2.78676e-61

Thioredoxin - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

1

113

S=576 I=96 E=2.78676e-61

Thioredoxin - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan IPR006662 [PR00421]

24

32

Thioredoxin-like subdomain

Iprscan IPR006662 [PR00421]

32

41

Thioredoxin-like subdomain

Iprscan IPR006662 [PR00421]

72

83

Thioredoxin-like subdomain

Iprscan IPR012335 [G3DSA:3.40.30.10]

2

111

Thioredoxin fold

Iprscan [PTHR10438:SF13]

14

108

-

Iprscan IPR015467 [PTHR10438]

14

108

Thioredoxin, core

Iprscan IPR013766 [PF00085]

4

107

Thioredoxin domain

Iprscan IPR005746 [TIGR01068]

8

108

Thioredoxin

Iprscan IPR017937 [PS00194]

25

43

Thioredoxin, conserved site

Iprscan IPR017936 [PS51352]

1

109

Thioredoxin-like

Iprscan IPR012336 [SSF52833]

1

109

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Y0Ne774a)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits