Xanthomonas axonopodis pv. citri str. 306

  1. XAC3601wzmNP_643908.1ABC transporter permease

wzm XAC3601
XAC3600
XAC3600
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC3602
XAC3602
ID wzm
AC NP_643908.1
LT XAC3601
SY
OR NC_003919 from 4272888 to 4273670 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE ABC transporter permease
IP ABC-2
CL
EC
GO Biological Process: transport (GO:0006810)
Cellular Component: membrane (GO:0016020)
Molecular Function: transporter activity (GO:0005215)
Molecular Function: ATP binding (GO:0005524)
coupled to transmembrane movement of substances (GO:0042626)
PM
AN
SQ 260 aa
 
........10........20........30........40........50
| | | | |
MQSHANLIFLFRQLLARELALKYKTTVLGALWLVLLPILMLCVYTLVFSG
IFKARWAGAQNSGDFALMLFAGLIPFSFLSEVLITSPTLVVGQPNFVKKV
VFPLPMLVVVKVAGGLVTAAISLLILLMAQAFLSEAPSAKALLAPVILLE
MVPMLLAIGWILSALGVYLRDVGQFVGILSSVLLFLSPIFFPPSAMPASV
SGLIAFNPLVTPISQLRAATLGHEALDLVSLGNHFVISIIAALLAYALFK
RLSRGFADVL
pubmed

13

260

S=430 I=38 E=1.16973e-43

Putative ABC-2 transporter integral membrane component

Pubmed 9988483

 

prodomImg

pubmed

13

260

S=429 I=39 E=1.65785e-43

ABC-2 type transport system integral membrane protein

Pubmed 12591881

 

prodomImg

pubmed

13

260

S=427 I=38 E=3.133e-43

Putative ABC transporter system integral membrane protein

Pubmed 9393727,10074083

 

prodomImg

pubmed

1

260

S=419 I=36 E=2.89414e-42

ABC transporter system integral membrane protein

Pubmed 17362509

 

prodomImg

pubmed

10

260

S=412 I=38 E=1.80586e-41

Putative ABC transporter system integral membrane protein

Pubmed 11763133,15473911

 

prodomImg

pubmed

18

259

S=381 I=41 E=1.03916e-37

Putative ATP transporter permease ; Plasmid

Pubmed 15033235

 

prodomImg

pubmed

10

260

S=370 I=33 E=2.70918e-36

ABC-transporter permease

Pubmed 11953381

 

prodomImg

pubmed

4

260

S=360 I=37 E=3.87009e-35

Wzm

Pubmed 11741945,15316277

 

prodomImg

pubmed

10

256

S=294 I=29 E=4.15813e-27

ABC transpoter

Pubmed 9805002

 

prodomImg

pubmed

15

231

S=282 I=31 E=1.07464e-25

Integral membrane component of ABC-transporter

Pubmed 9573168

 

prodomImg

sp

14

227

S=213 I=29 E=1.46286e-17

O-antigen export system permease protein rfbA - Myxococcus xanthus

Pubmed 8626291,

 

prodomImg

sp

1

260

S=163 I=22 E=1.67344e-11

O-antigen export system permease protein rfbA - Klebsiella pneumoniae

Pubmed 8752339,

 

prodomImg

sp

1

228

S=156 I=22 E=1.25399e-10

O-antigen export system permease protein rfbA - Klebsiella pneumoniae

Pubmed 7533882,

 

prodomImg

sp

13

222

S=153 I=28 E=2.67744e-10

Teichoic acid translocation permease protein tagG - Bacillus subtilis

Pubmed 7565096,

 

prodomImg

trembl

1

260

S=895 I=68 E=4.3643e-99

Putative ABC-transporter permease - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

144

S=521 I=70 E=8.22537e-54

Putative ABC-transporter permease - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

17

260

S=489 I=43 E=7.44823e-50

ABC 2 transport system integral membrane protein - Nitrosomonas europaea

 

prodomImg

Iprscan IPR013526 [PR00164]

104

129

ABC-2 transporter

Iprscan IPR013526 [PR00164]

178

197

ABC-2 transporter

Iprscan IPR013526 [PR00164]

30

51

ABC-2 transporter

Iprscan IPR013525 [PF01061]

9

221

ABC-2 type transporter

Iprscan IPR000412 [PS51012]

28

252

ABC-2

Iprscan [SignalP-NN(euk)]

1

16

-

Iprscan [tmhmm]

104

126

-

Iprscan [tmhmm]

146

168

-

Iprscan [tmhmm]

175

197

-

Iprscan [tmhmm]

230

249

-

Iprscan [tmhmm]

27

49

-

Iprscan [tmhmm]

69

91

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one nIP7WNC9)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits