Xanthomonas axonopodis pv. citri str. 306

  1. XAC3535xpsNNP_643842.1general secretion pathway protein N

xpsN XAC3535
XAC3534
XAC3534
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC3536
XAC3536
ID xpsN
AC NP_643842.1
LT XAC3535
SY
OR NC_003919 from 4180843 to 4181634 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE general secretion pathway protein N
IP
CL
EC
GO
PM
AN
SQ 263 aa
 
........10........20........30........40........50
| | | | |
MRLDMIGLRTWLLATVVGWALLVCVLAVAGLGKRVELLPDDPALVQRLPT
LPAPAPERLGAFEKYSEIAAHPAFAEDRLPHPFFLSGNDGGNAASTVRLT
GVLLTDNFKMATLTLDPQDSVRVQLGGEAVKGWRLLALQPRSATVEGPSG
TQTLELHVFNGQGGQPPTANAAARGAAPAAPPVPSPDAAALAPPQPPQPQ
PVAPVQQPGGQAPPTVPPQRSDGAQEAPRPSDDQMRAIRERIEARRRQLQ
QQRQSGSTPGQTQ
pubmed

1

164

S=669 I=81 E=1.32852e-72

General secretion pathway protein N ; Cell inner membrane Transmembrane Transport

Pubmed 10692359

 

prodomImg

sp

1

164

S=669 I=81 E=8.46802e-73

General secretion pathway protein N - Xanthomonas campestris pv. campestris

Pubmed 10692359,1313415,

 

prodomImg

trembl

1

164

S=723 I=87 E=3.16609e-78

General secretion pathway protein N precursor - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

164

S=713 I=86 E=4.48354e-77

General secretion pathway protein N - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

164

S=713 I=86 E=4.48354e-77

General secretion pathway protein N - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one CE2hwg8u)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits