Xanthomonas axonopodis pv. citri str. 306

  1. XAC3503NP_643810.1ISxac4 transposase

XAC3503
XAC3502
XAC3502
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC3504
XAC3504
ID
AC NP_643810.1
LT XAC3503
SY
OR NC_003919 from 4141727 to 4142011 on strand +
OS Xanthomonas axonopodis pv. citri str. 306
DE ISxac4 transposase
IP Transposase IS3/IS911
CL
EC
GO DNA-mediated (GO:0006313)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: transposase activity (GO:0004803)
PM
AN
SQ 94 aa
 
........10........20........30........40........50
| | | | |
MAADVFVLPGKFTETRIIAALKQADAGVPVKDICRQVGISTATYYQWKSK
YAGLKASELRRVKEIESENAKLKRMYADLALDNAAMKDLIAKKL
xansp

NP_642688.1 lcl|XAC2372-XAC2372

11

94

S=402 I=92 E=4.54859e-43

IS1479 transposase

xansp

NP_642916.1 lcl|XAC2603-XAC2603

10

94

S=397 I=89 E=2.22342e-42

ISxac4 transposase

xansp

NP_644779.1 lcl|XACb0051-XACb0051

11

93

S=242 I=51 E=1.27458e-23

ISxac2 transposase

xansp

NP_644742.1 lcl|XACb0014-XACb0014

11

93

S=240 I=51 E=2.16942e-23

ISxac2 transposase

xansp

NP_644690.1 lcl|XACa0004-XACa0004

11

93

S=240 I=51 E=2.16942e-23

ISxac2 transposase

xansp

NP_644245.1 lcl|XAC3944-XAC3944

11

93

S=240 I=51 E=2.16942e-23

ISxac2 transposase

xansp

NP_644071.1 lcl|XAC3764-XAC3764

11

93

S=240 I=51 E=2.16942e-23

ISxac2 transposase

xansp

NP_643591.1 lcl|XAC3283-XAC3283

11

93

S=240 I=51 E=2.16942e-23

ISxac2 transposase

xansp

NP_643199.1 lcl|XAC2890-XAC2890

11

93

S=240 I=51 E=2.16942e-23

ISxac2 transposase

pubmed

11

94

S=295 I=61 E=4.88159e-28

Transposase OrfA

Pubmed 9435062

 

prodomImg

pubmed

11

94

S=281 I=57 E=2.55643e-26

IS1400 transposase A

Pubmed 16902142

 

prodomImg

pubmed

11

94

S=271 I=56 E=3.58877e-25

Transposase

Pubmed 17488332

 

prodomImg

pubmed

11

94

S=271 I=54 E=3.95e-25

Transposase 6

Pubmed 17049458

 

prodomImg

pubmed

11

94

S=263 I=54 E=3.81143e-24

Low calcium response locus protein S ; Plasmid

Pubmed 1577700

 

prodomImg

pubmed

11

94

S=263 I=54 E=3.81143e-24

Low calcium response locus protein S ; Plasmid

Pubmed 9746557,9748454

 

prodomImg

pubmed

11

93

S=258 I=54 E=1.39726e-23

Insertion element ISR1 uncharacterized 10 kDa protein A3 ; Transposable

Pubmed 2544911

 

prodomImg

pubmed

11

94

S=255 I=52 E=3.52085e-23

IS1400 transposase A

Pubmed 7607411,8955291

 

prodomImg

pubmed

11

94

S=245 I=49 E=4.69071e-22

Putative transposase (Putative IS1617 transposase) ; Plasmid

Pubmed 9748454,9746557

 

prodomImg

pubmed

11

94

S=240 I=51 E=2.06512e-21

Putative transposase A

Pubmed 11150670

 

prodomImg

sp

11

94

S=263 I=54 E=2.19937e-24

Low calcium response locus protein S - Yersinia pseudotuberculosis

Pubmed 1577700,

 

prodomImg

sp

11

94

S=263 I=54 E=2.19937e-24

Low calcium response locus protein S - Yersinia pestis

Pubmed 9746557,9748454,

 

prodomImg

sp

11

93

S=258 I=54 E=8.06283e-24

Insertion element ISR1 uncharacterized 10 kDa protein A3 - Rhizobium sp.

Pubmed 2544911,

 

prodomImg

sp

11

93

S=227 I=47 E=4.21537e-20

Insertion element IS407 uncharacterized 10.0 kDa protein - Burkholderia cepacia (Pseudomonas cepacia)

 

prodomImg

trembl

11

93

S=315 I=64 E=1.4691e-29

ISxcc1 transposase - Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)

 

prodomImg

trembl

11

94

S=296 I=61 E=2.72376e-27

ISxcc1 transposase - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

11

94

S=296 I=61 E=2.72376e-27

ISxcc1 transposase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan IPR002514 [PF01527]

9

86

Transposase IS3/IS911

Iprscan IPR009057 [SSF46689]

9

47

Homeodomain-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one lCtefOpP)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits