Xanthomonas axonopodis pv. citri str. 306

  1. XAC3422az1NP_643729.1electron transfer protein azurin I

az1 XAC3422
XAC3421
XAC3421
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC3423
XAC3423
ID az1
AC NP_643729.1
LT XAC3422
SY
OR NC_003919 from 4029304 to 4029753 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE electron transfer protein azurin I
IP Cupredoxin; Azurin, proteobacteria
CL
EC
GO Molecular Function: copper ion binding (GO:0005507)
Molecular Function: electron carrier activity (GO:0009055)
PM
AN
SQ 149 aa
 
........10........20........30........40........50
| | | | |
MKLFSTIALCALALMAPAAWARTCAVTITGNDQMKFDQSTIKLAPECTQV
ELTLKHSGKMAATVMGHNWVLTKSADFQAVANAGVRSTIADSYLPKADAR
VIAHTKVIGGGDSTTVSFPTSKLSKGADYTFFCSFPGHWAMMKGTLTFG
pubmed

24

148

S=417 I=59 E=1.6278e-42

Azurin ; Signal

Pubmed 11440141

 

prodomImg

pubmed

24

148

S=406 I=56 E=3.44253e-41

Azurin I ; Signal

Pubmed 16832626

 

prodomImg

pubmed

24

148

S=399 I=55 E=2.83931e-40

Azurin-1 ; Copper Electron transport Metal-binding Periplasm

Pubmed 9761902

 

prodomImg

pubmed

24

149

S=375 I=54 E=2.35835e-37

Azurin-2 ; Copper Electron transport Metal-binding Periplasm

Pubmed 7640272,15299774

 

prodomImg

pubmed

24

148

S=375 I=54 E=2.485e-37

Azurin ; Copper Electron transport Metal-binding Periplasm Signal

Pubmed 2116366,6842609

 

prodomImg

pubmed

24

149

S=358 I=48 E=2.25398e-35

Azurin ; Copper Electron transport Metal-binding Periplasm

Pubmed 6274637,6960351

 

prodomImg

pubmed

24

148

S=353 I=50 E=9.92329e-35

Azurin ; Copper Electron transport Metal-binding Periplasm Signal

Pubmed 2537198,2116366

 

prodomImg

pubmed

24

147

S=343 I=48 E=1.74749e-33

Azurin iso-1 ; Copper Electron transport Metal-binding Periplasm Signal

Pubmed 9648216,2505762

 

prodomImg

pubmed

24

147

S=343 I=49 E=1.7628e-33

Azurin ; Copper Electron transport Metal-binding Periplasm

Pubmed 15299879

 

prodomImg

pubmed

24

148

S=341 I=49 E=3.24532e-33

Azurin

Pubmed 12730177

 

prodomImg

sp

24

148

S=407 I=56 E=1.96918e-41

Azurin - Alcaligenes sp.

 

prodomImg

sp

24

148

S=399 I=55 E=1.81905e-40

Azurin-1 - Alcaligenes xylosoxydans xylosoxydans (Achromobacter xylosoxidans)

Pubmed 9761902,

 

prodomImg

sp

24

148

S=398 I=55 E=2.6007e-40

Azurin precursor - Bordetella pertussis

 

prodomImg

sp

24

148

S=398 I=55 E=2.6007e-40

Azurin precursor - Bordetella parapertussis

 

prodomImg

sp

24

148

S=398 I=55 E=2.6007e-40

Azurin precursor - Bordetella bronchiseptica (Alcaligenes bronchisepticus)

 

prodomImg

trembl

22

149

S=676 I=99 E=5.23497e-73

Putative electron transfer protein azurin I - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

149

S=669 I=85 E=3.1e-72

Electron transfer protein azurin I - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

149

S=669 I=85 E=3.1e-72

Azurin - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Iprscan [PD003655]

24

149

-

Iprscan IPR008972 [G3DSA:2.60.40.420]

22

149

Cupredoxin

Iprscan IPR000923 [PF00127]

22

149

Blue (type 1) copper domain

Iprscan IPR014068 [TIGR02695]

24

148

Azurin, proteobacteria

Iprscan IPR000923 [PS00196]

126

142

Blue (type 1) copper domain

Iprscan [SignalP-NN(euk)]

1

21

-

Iprscan [tmhmm]

4

26

-

Iprscan IPR008972 [SSF49503]

22

149

Cupredoxin

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one FIwaFioX)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits