Xanthomonas axonopodis pv. citri str. 306

  1. XAC3362NP_643669.1TonB-like protein

XAC3362
XAC3361
XAC3361
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC3363
XAC3363
ID
AC NP_643669.1
LT XAC3362
SY
OR NC_003919 from 3958229 to 3959527 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE TonB-like protein
IP Gram-negative bacterial tonB protein; Peptidase M56, BlaR1
CL
EC
GO Biological Process: iron ion transport (GO:0006826)
Biological Process: protein transport (GO:0015031)
Cellular Component: membrane (GO:0016020)
Cellular Component: outer membrane-bounded periplasmic space (GO:0030288)
Molecular Function: iron ion transmembrane transporter activity (GO:0005381)
Molecular Function: protein transporter activity (GO:0008565)
PM
AN
SQ 432 aa
 
........10........20........30........40........50
| | | | |
MHLDLPLLLRITLYGSAAVLACLVLRRALRGWLGATAAYAIWAAVPLAVL
AAAIPGPPISAALPKMPAMVAMPLNLQSSEYAWAGQLLAVWVTGAVAMAG
ALWWRQHRFVRRLGVLHALDREIWAATRDVGLPVSVGLWRPRIVLPMDFD
TRYSAAERTLILAHERLHLRRGDLYANLLAALLLCIGWCNPLMHLAWRAF
RLDQELACDAEVLTRYPGKRRSYATAMLKTHGGAGWTPTACRWNAPHALT
QRVAALLKPAVEMRRARWNLRVVVAMAVMLNGACWAFQPARLQGMRVPGN
ALDFRTMQPPRYPPDAVAAGLAGFVELQIAVSPTGTPEHIAIVRSTPAGV
FDQTVLDAARHWRFTPALEDGKAVASEVRVPVRFELDPPDAAPAVADIHS
GTEAAARPHAADRSERVARCAPAGCAPRGGLQ
xansp

NP_640364.1 lcl|tonB-XAC0008

305

386

S=161 I=38 E=6.89904e-13

TonB protein

xansp

NP_642432.1 lcl|XAC2115-XAC2115

309

385

S=138 I=34 E=4.37323e-10

hypothetical protein

xansp

NP_641984.1 lcl|XAC1652-XAC1652

307

385

S=120 I=38 E=6.40742e-08

hypothetical protein

xansp

NP_640426.1 lcl|XAC0070-XAC0070

130

229

S=118 I=29 E=1.32118e-07

ankyrin-like protein

xansp

NP_644351.1 lcl|XAC4052-XAC4052

310

366

S=113 I=37 E=4.59656e-07

TonB-like protein

xansp

NP_641983.1 lcl|XAC1651-XAC1651

286

384

S=109 I=34 E=1.47851e-06

TonB-like protein

xansp

NP_643083.1 lcl|XAC2774-XAC2774

302

386

S=107 I=34 E=2.36753e-06

TonB-like protein

pubmed

305

386

S=161 I=38 E=1.11796e-10

TonB

Pubmed 12646254

 

prodomImg

pubmed

305

386

S=161 I=38 E=1.11796e-10

Protein tonB ; Cell inner membrane Periplasm transport Repeat Signal-anchor Transmembrane

Pubmed 9371459,18304669

 

prodomImg

pubmed

133

229

S=132 I=31 E=2.93522e-07

Regulatory protein blaR1 ; Cell membrane Transmembrane

Pubmed 3040663,3260234

 

prodomImg

pubmed

133

229

S=132 I=31 E=3.34532e-07

Penicillinase antirepressor penJ

Pubmed 3040662

 

prodomImg

pubmed

310

386

S=127 I=32 E=1.32649e-06

TonB2

Pubmed 15557661

 

prodomImg

pubmed

309

386

S=126 I=35 E=1.664e-06

TonB protein

Pubmed 15689115

 

prodomImg

pubmed

310

374

S=121 I=34 E=7.39004e-06

TonB2 protein

Pubmed 15689115

 

prodomImg

pubmed

130

229

S=120 I=32 E=9.27035e-06

Putative uncharacterized protein

Pubmed 14617179

 

prodomImg

pubmed

310

386

S=118 I=36 E=1.63387e-05

TonB-like protein

Pubmed 18324396

 

prodomImg

pubmed

307

375

S=117 I=38 E=2.44005e-05

Protein tonB ; Cell inner membrane Periplasm transport Repeat Transmembrane

Pubmed 8704984

 

prodomImg

sp

305

386

S=161 I=38 E=7.03926e-11

Protein tonB - Xanthomonas campestris pv. campestris

 

prodomImg

sp

305

386

S=161 I=38 E=7.03926e-11

Protein tonB - Xanthomonas campestris pv. campestris (strain B100)

Pubmed 9371459,18304669,

 

prodomImg

sp

133

229

S=132 I=31 E=1.84817e-07

Regulatory protein blaR1 - Bacillus licheniformis

Pubmed 3040663,3260234,2404938,

 

prodomImg

sp

307

375

S=117 I=38 E=1.53638e-05

Protein tonB - Pseudomonas aeruginosa

Pubmed 8704984,

 

prodomImg

sp

310

386

S=116 I=34 E=1.54983e-05

Protein tonB - Vibrio cholerae

Pubmed 9781885,

 

prodomImg

trembl

1

432

S=1453 I=68 E=1.99999e-166

TonB-like protein - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

432

S=1366 I=66 E=6.96078e-156

TonB-like protein - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

361

S=1278 I=71 E=3.43359e-145

Peptidase, M56 family protein - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Iprscan IPR003538 [PR01374]

304

325

Gram-negative bacterial tonB protein

Iprscan IPR003538 [PR01374]

325

343

Gram-negative bacterial tonB protein

Iprscan IPR003538 [PR01374]

344

361

Gram-negative bacterial tonB protein

Iprscan IPR008756 [PF05569]

133

228

Peptidase M56, BlaR1

Iprscan IPR006260 [TIGR01352]

310

387

TonB, C-terminal

Iprscan [SignalP-NN(euk)]

1

51

-

Iprscan [tmhmm]

175

197

-

Iprscan [tmhmm]

32

54

-

Iprscan [tmhmm]

6

25

-

Iprscan [tmhmm]

82

104

-

Iprscan [SSF74653]

300

387

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one vwA95vWt)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits