Xanthomonas axonopodis pv. citri str. 306

  1. XAC3243pilDNP_643551.1type IV pre-pilin leader peptidase

pilD XAC3243
XAC3242
XAC3242
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC3244
XAC3244
ID pilD
AC NP_643551.1
LT XAC3243
SY
OR NC_003919 from 3821670 to 3822533 on strand +
OS Xanthomonas axonopodis pv. citri str. 306
DE type IV pre-pilin leader peptidase
IP Peptidase A24A, prepilin type IV; Peptidase A24A, N-terminal
CL
EC
GO Cellular Component: membrane (GO:0016020)
Molecular Function: aspartic-type endopeptidase activity (GO:0004190)
PM
AN
SQ 287 aa
 
........10........20........30........40........50
| | | | |
MAFLDQHPGLGFPAAAGLGLLIGSFLNVVILRLPKRMEWQWRRDAREILE
LPDIYEPPPPGIVVEPSHDPVTGDKLKWWENIPVLSWAMLRGKSRYSGKP
ISIQYPLVELLTSILCVASVWRFGFGWQGFGAIVLSCFLVAMSGIDLRHK
LLPDQLTLPLMWLGLVGSMDNLYMPAKPALLGAAVGYVSLWTVWWLFKQL
TGKEGMGHGDFKLLAALGAWCGLKGILPIILISSLVGAILGSIWLVAKGR
DRATPIPFGPYLAIAGWVVFFWGNDLVDGYLHFAGLR
pubmed

1

287

S=1327 I=91 E=2.787e-152

Type 4 prepilin-like proteins leader peptide-processing enzyme EC=3.4.23.43 EC=2.1.1.- ; Cell inner membrane Hydrolase Methyltransferase Multif

Pubmed 8817497

 

prodomImg

pubmed

27

287

S=545 I=51 E=1.914e-57

Type 4 prepilin-like proteins leader peptide-processing enzyme EC=3.4.23.43 EC=2.1.1.- ; Cell inner membrane Hydrolase Methyltransferase Multifu

Pubmed 1971619,1898929

 

prodomImg

pubmed

27

285

S=539 I=44 E=9.52049e-57

Type 4 prepilin-like proteins leader peptide-processing enzyme EC=3.4.23.43 EC=2.1.1.- ; Cell inner membrane Hydrolase Methyltransferase Multifunctional

Pubmed 7905475

 

prodomImg

pubmed

27

286

S=528 I=44 E=1.89422e-55

PilD ; Hydrolase Protease Transmembrane

Pubmed 18523167

 

prodomImg

pubmed

27

281

S=526 I=47 E=3.83829e-55

Type 4 prepilin-like proteins leader peptide-processing enzyme EC=3.4.23.43 EC=2.1.1.- ; Cell inner membrane Hydrolase Methyltransferase Multifunctional

Pubmed 8820654

 

prodomImg

pubmed

27

286

S=525 I=43 E=4.98577e-55

PilD ; Hydrolase Protease Transmembrane

Pubmed 18523167

 

prodomImg

pubmed

27

286

S=525 I=43 E=5.07347e-55

PilD ; Hydrolase Protease Transmembrane

Pubmed 18523167

 

prodomImg

pubmed

27

286

S=524 I=43 E=6.25434e-55

Type 4 prepilin peptidase PilD (PilD) EC=3.4.99.- ; Hydrolase Protease Transmembrane

Pubmed 18523167

 

prodomImg

pubmed

27

283

S=519 I=45 E=2.65914e-54

Type 4 prepilin-like proteins leader peptide-processing enzyme EC=3.4.23.43 EC=2.1.1.- ; Cell inner membrane Hydrolase Methyltransferase Multifunctional

Pubmed 9826339

 

prodomImg

pubmed

27

286

S=519 I=43 E=2.75352e-54

PilD ; Hydrolase Protease Transmembrane

Pubmed 18523167

 

prodomImg

sp

1

287

S=1327 I=91 E=1.75687e-152

Type 4 prepilin-like proteins leader peptide-processing enzyme [Includes: Leader peptidase - Xanthomonas campestris pv. campestris

Pubmed 8817497,

 

prodomImg

sp

27

286

S=567 I=51 E=2.05877e-60

Type 4 prepilin-like proteins leader peptide-processing enzyme [Includes: Leader peptidase - Pseudomonas stutzeri (Pseudomonas perfectomarina)

 

prodomImg

sp

27

287

S=545 I=51 E=1.20655e-57

Type 4 prepilin-like proteins leader peptide-processing enzyme - Pseudomonas aeruginosa

Pubmed 1971619,1898929,9224881,8057924,8340405,9668097,

 

prodomImg

sp

27

285

S=539 I=44 E=6.00151e-57

Type 4 prepilin-like proteins leader peptide-processing enzyme - Pseudomonas putida

Pubmed 7905475,

 

prodomImg

sp

27

281

S=526 I=47 E=2.41957e-55

Type 4 prepilin-like proteins leader peptide-processing enzyme [Includes: Leader peptidase - Aeromonas hydrophila

Pubmed 8820654,

 

prodomImg

trembl

1

287

S=1349 I=93 E=4.99692e-154

Type II secretory pathway prepilin signal peptidase - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

287

S=1335 I=92 E=2.61683e-152

Type IV pre-pilin leader peptidase - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

287

S=1335 I=92 E=2.61683e-152

Type IV pre-pilin leader peptidase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Iprscan IPR014032 [PR00864]

142

159

Peptidase A24A, prepilin type IV, bacterial

Iprscan IPR014032 [PR00864]

199

209

Peptidase A24A, prepilin type IV, bacterial

Iprscan IPR014032 [PR00864]

210

221

Peptidase A24A, prepilin type IV, bacterial

Iprscan IPR014032 [PR00864]

222

237

Peptidase A24A, prepilin type IV, bacterial

Iprscan IPR000045 [PF01478]

133

242

Peptidase A24A, prepilin type IV

Iprscan IPR010627 [PF06750]

17

126

Peptidase A24A, N-terminal

Iprscan [SignalP-NN(euk)]

1

31

-

Iprscan [tmhmm]

10

32

-

Iprscan [tmhmm]

123

145

-

Iprscan [tmhmm]

178

197

-

Iprscan [tmhmm]

225

247

-

Iprscan [tmhmm]

262

284

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 9hwDuBrj)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits