Xanthomonas axonopodis pv. citri str. 306

  1. XAC2979ptsINP_643288.1phosphotransferase system enzyme I

ptsI XAC2979
XAC2978
XAC2978
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC2980
XAC2980
ID ptsI
AC NP_643288.1
LT XAC2979
SY
OR NC_003919 from 3479594 to 3481324 on strand +
OS Xanthomonas axonopodis pv. citri str. 306
DE phosphotransferase system enzyme I
IP Phosphotransferase system, PEP-utilising enzyme, N-terminal; Pyruvate/Phosphoenolpyruvate kinase, catalytic core
CL
EC
GO Biological Process: phosphoenolpyruvate-dependent sugar phosphotransferase system (GO:0009401)
Biological Process: phosphorylation (GO:0016310)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: sugar:hydrogen symporter activity (GO:0005351)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: phosphoenolpyruvate-protein phosphotransferase activity (GO:0008965)
transferring phosphorus-containing groups (GO:0016772)
PM
AN
SQ 576 aa
 
........10........20........30........40........50
| | | | |
MSLRLRGHGAARGNALGRARVRQSHTLEVAEQRVPANQVETQLQRLHAAI
ASARVEMQQLRDRLHGALAREVGEFLELHALLLDDPELLQGLDELIRTHR
YSADYALRVQRDRLAAVFDGMEDAYLKSRMDDLDHVIGRIHAFLHKRAPD
LKGVAGEILVCDNVAPSELAQLQAQGVVGIVTTAGSTLSHSAILARSLHL
PLVVGVSDALQRIEDGDVLIVDAGSGQVIVDPKPEHLRDYRERLRALAKE
QRELGRLRSKPTRTRDNVDITLLANAESLEDVANAHALGASGLGLYRTEF
LFLQRNELPDEDEQFHTYRDTVLGMSGRPVTIRTLDLGADKADRTGLTLS
DEDNPALGLRGVRLSLARPAVAQAQLRAILRASGYGPVRILVPMVSGREE
ILQLRKQLKKLTAQLREEGHEIAEHIPLGAMIEVPAAALALDCFIDDIDF
LSIGTNDLVQYLLAVDRNNEALGELYSPLHPAVLRLIAQVIATGRTYGKP
VAVCGEIAGDPRFVPMLLALGLTEFSLHPATLLEVRRAVRDTHLGDLRVH
GEKLLRARDRKGIEKWLTGHAQGLLR
xansp

NP_642816.1 lcl|fruB-XAC2501

158

555

S=618 I=40 E=4.76482e-68

multiphosphoryl transfer protein

xansp

NP_642367.1 lcl|ppsA-XAC2041

352

534

S=210 I=30 E=1.21441e-18

phosphoenolpyruvate synthase

pubmed

32

567

S=948 I=38 E=5.4983e-106

Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) ; Cytoplasm Magnesium Metal-binding Phosphotransferase Sugar trans

Pubmed 15670601

 

prodomImg

pubmed

96

559

S=931 I=46 E=7.3832e-104

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 1653223

 

prodomImg

pubmed

30

536

S=928 I=40 E=1.8124e-103

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 7670643

 

prodomImg

pubmed

27

539

S=908 I=42 E=4.40304e-101

Putative phosphoenolpyruvate-protein phosphotransferase ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 18328084

 

prodomImg

pubmed

102

548

S=891 I=41 E=4.39569e-99

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 12855720

 

prodomImg

pubmed

39

540

S=887 I=37 E=1.46408e-98

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 15590099

 

prodomImg

pubmed

28

540

S=882 I=36 E=5.36728e-98

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 9726852

 

prodomImg

pubmed

40

555

S=880 I=36 E=1.13604e-97

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 7686067

 

prodomImg

pubmed

32

555

S=877 I=36 E=2.28199e-97

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 2457575,2960675

 

prodomImg

pubmed

32

555

S=875 I=36 E=4.46555e-97

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 1655788

 

prodomImg

sp

32

555

S=966 I=37 E=2.28292e-108

Phosphoenolpyruvate-protein phosphotransferase - Bacillus halodurans

 

prodomImg

sp

96

559

S=931 I=46 E=4.65085e-104

Phosphoenolpyruvate-protein phosphotransferase - Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337))

Pubmed 1653223,

 

prodomImg

sp

30

536

S=928 I=40 E=1.14168e-103

Phosphoenolpyruvate-protein phosphotransferase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 7670643,

 

prodomImg

sp

30

536

S=926 I=39 E=1.70499e-103

Phosphoenolpyruvate-protein phosphotransferase - Bacillus sp. (strain S)

 

prodomImg

sp

28

555

S=904 I=36 E=7.9654e-101

Phosphoenolpyruvate-protein phosphotransferase - Bacillus megaterium

 

prodomImg

trembl

23

576

S=2697 I=96 E=0

Enzyme I of the phosphotransferase system - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

23

575

S=2592 I=92 E=0

Phosphotransferase system enzyme I - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

23

575

S=2582 I=92 E=0

Phosphotransferase system enzyme I - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan [PD000940]

342

529

-

Iprscan IPR006318 [PR01736]

294

313

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

449

464

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

466

481

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

502

514

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR008731 [G3DSA:1.10.274.10]

24

144

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR015813 [G3DSA:3.20.20.60]

251

575

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan [PTHR22931]

3

541

-

Iprscan [PTHR22931:SF10]

3

541

-

Iprscan IPR008279 [PF00391]

147

226

PEP-utilising enzyme, mobile region

Iprscan IPR000121 [PF02896]

251

544

PEP-utilizing enzyme

Iprscan IPR008731 [PF05524]

5

130

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR006318 [TIGR01417]

5

568

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR000121 [PS00742]

449

467

PEP-utilizing enzyme

Iprscan IPR008731 [SSF47831]

25

147

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR015813 [SSF51621]

246

547

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan IPR008279 [SSF52009]

128

250

PEP-utilising enzyme, mobile region

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one OeHt5D4D)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits