Xanthomonas axonopodis pv. citri str. 306

  1. XAC2896NP_643205.1alcohol dehydrogenase

XAC2896
XAC2895
XAC2895
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC2897
XAC2897
ID
AC NP_643205.1
LT XAC2896
SY
OR NC_003919 from 3396136 to 3397143 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE alcohol dehydrogenase
IP Alcohol dehydrogenase superfamily, zinc-containing; NAD(P)-binding
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: binding (GO:0005488)
PM
AN
SQ 335 aa
 
........10........20........30........40........50
| | | | |
MQAIRLRHPAAIASLQSVALPDPGQPARGQIRVRLHASSLNFHDLGVVLG
QMPTADGRIPMSDGAGVVEAVGPEVDEFAVGDQVVSTFFPQWLDGEPLHA
GFATTPGDGVDGYARSAVVADARAFTHAPRGYSHAEAATLTTAGVTAWRA
LAVNGGLKAGDSVLVLGTGGVSIFALQLAKAMGARVIATSSSDEKLEKVR
ALGADHVINYRQHPEWSAQVLDITEGRGVDHVVEVGGPGTLTQSIRAARV
GGHIALIGVLTGAGGPVPTAEMMGRQQRLQGLVVGSRKHQQDLVRALDSL
PLRPVIDRSFALDEIGEAFALQKSGGHLGKIALEF
xansp

NP_640557.1 lcl|adh-XAC0201

1

335

S=445 I=38 E=1.96517e-47

alcohol dehydrogenase

xansp

NP_641146.1 lcl|XAC0794-XAC0794

1

335

S=206 I=29 E=2.00362e-18

quinone reductase

xansp

NP_641358.1 lcl|XAC1011-XAC1011

14

212

S=149 I=32 E=1.74775e-11

oxidoreductase

xansp

NP_641087.1 lcl|XAC0734-XAC0734

136

325

S=134 I=29 E=1.13819e-09

alcohol dehydrogenase C

xansp

NP_641005.1 lcl|adhC-XAC0652

136

319

S=116 I=30 E=1.81954e-07

alcohol dehydrogenase class III

xansp

NP_642354.1 lcl|fdh-XAC2028

120

237

S=112 I=34 E=4.62506e-07

glutathione-dependent formaldehyde dehydrogenase

xansp

NP_641369.1 lcl|tdh-XAC1022

160

335

S=111 I=25 E=6.49817e-07

L-threonine 3-dehydrogenase

xansp

NP_643135.1 lcl|XAC2826-XAC2826

129

281

S=109 I=29 E=1.19632e-06

alcohol dehydrogenase

xansp

NP_640387.1 lcl|yahK-XAC0031

107

319

S=103 I=26 E=6.32513e-06

alcohol dehydrogenase

pubmed

21

334

S=478 I=36 E=2.50349e-49

Zinc-binding alcohol dehydrogenase (NADPH:quinone reductase or related Zn-dependent oxidoreductase)

Pubmed 18004300

 

prodomImg

pubmed

160

335

S=368 I=50 E=5.71921e-36

Putative formaldehyde dehydrogenase

Pubmed 15743951,9501423

 

prodomImg

pubmed

113

335

S=261 I=32 E=5.70699e-23

NADH:quinone reductase and related Zn-dependent oxidoreductases

Pubmed 15608629

 

prodomImg

pubmed

95

335

S=245 I=36 E=4.86996e-21

Putative NADPH:quinone oxidoreductase (Putative alcohol dehydrogenase) EC=1.1.1.1

Pubmed 9177244,9573182

 

prodomImg

pubmed

118

334

S=236 I=37 E=6.21133e-20

Putative oxidoreductase

Pubmed 10627032

 

prodomImg

pubmed

113

333

S=235 I=37 E=6.83653e-20

Zn-dependent alcohol dehydrogenase class III EC=1.1.1.1 ; Oxidoreductase

Pubmed 15028704

 

prodomImg

pubmed

112

333

S=228 I=33 E=6.26049e-19

Alcohol dehydrogenase

Pubmed 10940013

 

prodomImg

pubmed

112

333

S=228 I=33 E=6.26049e-19

6-hydroxyhexanoate dehydrogenase

Pubmed 3338974,10543838

 

prodomImg

pubmed

14

281

S=226 I=30 E=9.76608e-19

Putative uncharacterized protein

Pubmed 12019272

 

prodomImg

pubmed

111

333

S=221 I=33 E=3.42749e-18

Putative NADPH:quinone oxidoreductase GrhO7

Pubmed 12323376

 

prodomImg

sp

23

334

S=544 I=39 E=1.74696e-57

Zinc-type alcohol dehydrogenase-like protein C1773.06c - Schizosaccharomyces pombe (Fission yeast)

 

prodomImg

sp

107

335

S=219 I=31 E=4.48981e-18

Alcohol dehydrogenase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 8049268,

 

prodomImg

sp

129

335

S=213 I=30 E=2.41559e-17

Putative quinone oxidoreductase - Homo sapiens (Human)

Pubmed 9305847,15067011,17224074,

 

prodomImg

sp

93

333

S=207 I=31 E=1.22268e-16

Alcohol dehydrogenase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 8020473,

 

prodomImg

sp

107

334

S=207 I=31 E=1.28835e-16

Alcohol dehydrogenase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 1735726,4578954,436831,8049268,

 

prodomImg

trembl

1

335

S=1570 I=92 E=0

Putative alcohol dehydrogenase - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

335

S=1433 I=83 E=3.81029e-164

Alcohol dehydrogenase - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

1

335

S=1433 I=83 E=3.81029e-164

Alcohol dehydrogenase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan IPR016040 [G3DSA:3.40.50.720]

122

310

NAD(P)-binding

Iprscan IPR002085 [PTHR11695]

14

335

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan [PTHR11695:SF21]

106

335

-

Iprscan [PTHR11695:SF21]

14

335

-

Iprscan [PTHR11695:SF21]

14

88

-

Iprscan IPR013149 [PF00107]

159

298

Alcohol dehydrogenase, zinc-binding

Iprscan IPR013154 [PF08240]

28

85

Alcohol dehydrogenase GroES-like

Iprscan [SignalP-NN(euk)]

1

21

-

Iprscan IPR011032 [SSF50129]

1

163

GroES-like

Iprscan IPR016040 [SSF51735]

133

302

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one E7LLsoym)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits