Xanthomonas axonopodis pv. citri str. 306

  1. XAC2783trxNP_643092.1thioredoxin

trx XAC2783
XAC2782
XAC2782
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC2784
XAC2784
ID trx
AC NP_643092.1
LT XAC2783
SY
OR NC_003919 from 3263482 to 3264342 on strand +
OS Xanthomonas axonopodis pv. citri str. 306
DE thioredoxin
IP Thioredoxin; Thioredoxin-like fold
CL
EC
GO Biological Process: glycerol ether metabolic process (GO:0006662)
Biological Process: cell redox homeostasis (GO:0045454)
Molecular Function: electron carrier activity (GO:0009055)
Molecular Function: protein disulfide oxidoreductase activity (GO:0015035)
PM
AN
SQ 286 aa
 
........10........20........30........40........50
| | | | |
MSDKPHVFDATTDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKL
AGEYNGAFELGKVDVDKEQQIAAAFQIRSVPTVFLVKGGEIVDGFPGAMP
EGQVREFLTQHGVLPAEPQVAEEDVPLAPLDPQAQAAALREAIAAEPDKD
ELKLDLALALLKTGDTAEAERLIDALPANLATDDRAVRAKARLSFANVLK
DAPDAGTLQSAVDANSADLRARHLLGVRHLLDGNDEAALEQFLEMLRQDR
TFDDNLPRRSLIDAFRVIEDEDLVGRYRRKMSALVF
xansp

NP_644136.1 lcl|trxA-XAC3830

1

108

S=235 I=44 E=4.70391e-22

thioredoxin

xansp

NP_641612.1 lcl|trx-XAC1277

15

108

S=164 I=34 E=2.1866e-13

thioredoxin

xansp

NP_640465.1 lcl|trxA-XAC0109

29

90

S=104 I=31 E=3.54221e-06

thioredoxin

pubmed

18

286

S=271 I=27 E=3.04465e-24

YcaC

Pubmed 11325940

 

prodomImg

pubmed

8

111

S=262 I=43 E=3.37763e-23

Thioredoxin ; Electron transport Redox-active center

Pubmed 3294835

 

prodomImg

pubmed

1

108

S=250 I=44 E=9.69207e-22

Thioredoxin-1 ; Electron transport Redox-active center

Pubmed 1561103,8253691

 

prodomImg

pubmed

1

108

S=250 I=44 E=9.69207e-22

Thioredoxin-1 ; Electron transport Host-virus interaction Redox-active center

Pubmed 6098320,6099324

 

prodomImg

pubmed

11

111

S=245 I=43 E=3.43131e-21

Thioredoxin-1 ; Electron transport Redox-active center

Pubmed 3096973,3926769

 

prodomImg

pubmed

6

111

S=236 I=40 E=4.85912e-20

Thioredoxin ; Chloroplast Electron transport Plastid Redox-active center

Pubmed 8003693

 

prodomImg

pubmed

13

111

S=235 I=38 E=6.5358e-20

Thioredoxin M-type, chloroplastic ; Electron transport Plastid Redox-active center Transit peptide

Pubmed 7632918,1741302

 

prodomImg

pubmed

7

111

S=235 I=40 E=6.59303e-20

Thioredoxin C-2 ; Electron transport Redox-active center

Pubmed 3040729,2917572

 

prodomImg

pubmed

10

111

S=233 I=42 E=1.00193e-19

Thioredoxin-1 ; Electron transport Redox-active center

Pubmed 2492995

 

prodomImg

pubmed

12

108

S=231 I=40 E=2.0126e-19

Thioredoxin C-1 ; Electron transport Redox-active center

Pubmed 7021558

 

prodomImg

sp

18

286

S=300 I=32 E=5.2488e-28

Uncharacterized protein ybbN - Escherichia coli (strain K12)

 

prodomImg

sp

8

111

S=262 I=43 E=2.1293e-23

Thioredoxin - Chlorobium limicola f.sp. thiosulfatophilum

Pubmed 3294835,

 

prodomImg

sp

1

111

S=256 I=42 E=1.0318e-22

Thioredoxin-2 - Chlorobium tepidum

 

prodomImg

sp

1

111

S=254 I=42 E=1.75619e-22

Thioredoxin - Haemophilus influenzae

 

prodomImg

sp

1

108

S=250 I=44 E=6.11e-22

Thioredoxin-1 - Shigella flexneri

 

prodomImg

trembl

1

286

S=1212 I=85 E=1.6619e-137

Thioredoxin - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

286

S=1208 I=84 E=5.88366e-137

Thioredoxin - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

286

S=1208 I=84 E=5.88366e-137

Thioredoxin - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Iprscan IPR006662 [PR00421]

28

36

Thioredoxin-like subdomain

Iprscan IPR006662 [PR00421]

36

45

Thioredoxin-like subdomain

Iprscan IPR006662 [PR00421]

76

87

Thioredoxin-like subdomain

Iprscan IPR012335 [G3DSA:3.40.30.10]

4

111

Thioredoxin fold

Iprscan [PTHR10438:SF13]

16

110

-

Iprscan IPR015467 [PTHR10438]

16

110

Thioredoxin, core

Iprscan IPR013766 [PF00085]

6

111

Thioredoxin domain

Iprscan IPR005746 [TIGR01068]

10

112

Thioredoxin

Iprscan IPR017937 [PS00194]

29

47

Thioredoxin, conserved site

Iprscan IPR017936 [PS51352]

1

113

Thioredoxin-like

Iprscan IPR012336 [SSF52833]

5

117

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gRhV9CFD)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits