Xanthomonas axonopodis pv. citri str. 306

  1. XAC2750NP_643059.1reductase

XAC2750
XAC2749
XAC2749
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC2751
XAC2751
ID
AC NP_643059.1
LT XAC2750
SY
OR NC_003919 from 3221604 to 3222974 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE reductase
IP Adrenodoxin reductase; Mercuric reductase; FAD/NAD-linked reductase, dimerisation
CL
EC
GO Biological Process: cell redox homeostasis (GO:0045454)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: FAD binding (GO:0050660)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: electron carrier activity (GO:0009055)
PM
AN
SQ 456 aa
 
........10........20........30........40........50
| | | | |
MSARYDYDVVILGGGSGGLAAGFRAAKHGARVAIMEPDELGGTCVNLGCV
PKKAMWLAADLAGKIELASALGFDVPRPTLVWQELVTHRQGYIANIHASY
RRRLNEDGVVLIPQRGVLQDRHTVMGSDGVPVTAGHIVIATGAHALRPDV
EGAEHGEVSDDFFNLCHAPEQVAIIGGGYIAVEIAGLLQALGSRVHLFVQ
GERLLERFDAELTLQLADNLRHLGVRLHFGFTTTALERDMHGALRVHGHS
VHPREQGNDVFDKVFFAVGRRANTAGLGLDTVGVALGDKGEVVVDDRQTT
NVPNIHAIGDVGGKVGLTPVAIAAGRKLMDRLFGHQPDARMDYENVPSVV
FSHPPLGNVGLTEEQARARYNGAVRVYRSNFRPMLHALADAPQRSLFKLV
CVGEEERVVGVHLLGESADEMLQGFAVAVKMGATKRDFDETVAIHPTSSE
EIVLMH
xansp

NP_643966.1 lcl|lpdA-XAC3659

40

452

S=354 I=27 E=3.76725e-36

dihydrolipoamide dehydrogenase

xansp

NP_641866.1 lcl|ldp-XAC1533

40

452

S=198 I=23 E=2.78086e-17

dihydrolipoamide dehydrogenase

xansp

NP_641258.1 lcl|ahpF-XAC0906

127

325

S=106 I=30 E=3.33805e-06

alkyl hydroperoxide reductase subunit F

pubmed

6

455

S=921 I=44 E=7.94117e-103

Glutathione reductase EC=1.8.1.7 ; Cytoplasm FAD Flavoprotein NADP Oxidoreductase Redox-active center

Pubmed 8525054

 

prodomImg

pubmed

28

455

S=880 I=43 E=7.06068e-98

Glutathione reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 11160120

 

prodomImg

pubmed

28

455

S=866 I=43 E=3.72998e-96

Glutathione reductase EC=1.8.1.7 ; Cytoplasm FAD Flavoprotein NADP Oxidoreductase Redox-active center

Pubmed 3521741,8041620

 

prodomImg

pubmed

28

455

S=849 I=42 E=4.31868e-94

Glutathione reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 14563169

 

prodomImg

pubmed

1

455

S=810 I=39 E=2.78108e-89

Glutathione reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 16549667

 

prodomImg

pubmed

29

455

S=807 I=41 E=5.07553e-89

Glutathione reductase, mitochondrial EC=1.8.1.7 ; Acetylation Alternative initiation Cytoplasm FAD Flavoprotein Mitochondrion NADP Oxidoreductase

Pubmed 9268726,2185014

 

prodomImg

pubmed

6

455

S=807 I=39 E=6.47894e-89

Glutathione reductase, mitochondrial EC=1.8.1.7 ; Acetylation Alternative initiation Cytoplasm FAD Flavoprotein Mitochondrion NADP Oxidoreductase

Pubmed 2185014,10708558

 

prodomImg

pubmed

32

455

S=804 I=41 E=1.32433e-88

Glutathione reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 17079028

 

prodomImg

pubmed

7

455

S=796 I=38 E=1.09227e-87

Glutathione reductase EC=1.8.1.7 ; Cytoplasm FAD Flavoprotein NADP Oxidoreductase Redox-active center

Pubmed 9287302,10620777

 

prodomImg

pubmed

32

455

S=790 I=40 E=6.99612e-87

Glutathione reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 9271084

 

prodomImg

sp

6

455

S=921 I=44 E=4.99818e-103

Glutathione reductase - Streptococcus thermophilus

Pubmed 8525054,

 

prodomImg

sp

28

455

S=866 I=43 E=2.34765e-96

Glutathione reductase - Escherichia coli (strain K12)

Pubmed 3521741,8041620,2006135,8061609,

 

prodomImg

sp

6

453

S=819 I=40 E=1.26883e-90

Glutathione reductase, mitochondrial precursor - Callithrix jacchus (Common marmoset)

 

prodomImg

sp

28

455

S=817 I=43 E=2.06751e-90

Glutathione reductase - Haemophilus influenzae

 

prodomImg

sp

29

455

S=807 I=41 E=3.19455e-89

Glutathione reductase, mitochondrial precursor - Mus musculus (Mouse)

Pubmed 9268726,2185014,

 

prodomImg

trembl

1

456

S=2130 I=91 E=0

Glutathione reductase - Xanthomonas campestris pv. phaseoli

 

prodomImg

trembl

1

456

S=2129 I=91 E=0

Putative glutathione reductase - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

456

S=1926 I=83 E=0

Reductase - Xanthomonas campestris pv. campestris

 

prodomImg

Iprscan [PD000139]

141

211

-

Iprscan IPR013027 [PR00368]

137

146

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

171

196

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

262

276

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

305

312

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

8

30

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan [PR00411]

137

146

-

Iprscan [PR00411]

171

196

-

Iprscan [PR00411]

262

276

-

Iprscan [PR00411]

305

312

-

Iprscan [PR00411]

342

363

-

Iprscan [PR00411]

40

55

-

Iprscan [PR00411]

408

423

-

Iprscan [PR00411]

430

450

-

Iprscan [PR00411]

8

30

-

Iprscan IPR000759 [PR00419]

172

186

Adrenodoxin reductase

Iprscan IPR000759 [PR00419]

8

30

Adrenodoxin reductase

Iprscan IPR000815 [PR00945]

171

188

Mercuric reductase

Iprscan IPR000815 [PR00945]

18

36

Mercuric reductase

Iprscan IPR000815 [PR00945]

191

206

Mercuric reductase

Iprscan IPR004099 [G3DSA:3.30.390.30]

345

455

Pyridine nucleotide-disulphide oxidoreductase, dimerisation

Iprscan [G3DSA:3.50.50.60]

4

344

-

Iprscan [PTHR22912]

10

456

-

Iprscan [PTHR22912:SF27]

10

456

-

Iprscan IPR001327 [PF00070]

171

269

Pyridine nucleotide-disulphide oxidoreductase, NAD-binding region

Iprscan IPR004099 [PF02852]

346

456

Pyridine nucleotide-disulphide oxidoreductase, dimerisation

Iprscan IPR013027 [PF07992]

8

316

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR012999 [PS00076]

41

51

Pyridine nucleotide-disulphide oxidoreductase, class I, active site

Iprscan [SSF51905]

6

306

-

Iprscan IPR016156 [SSF55424]

343

456

FAD/NAD-linked reductase, dimerisation

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one buciKifO)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits