Xanthomonas axonopodis pv. citri str. 306

  1. XAC2714mrsANP_643023.1phosphohexose mutase

mrsA XAC2714
XAC2713
XAC2713
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC2715
XAC2715
ID mrsA
AC NP_643023.1
LT XAC2714
SY
OR NC_003919 from 3173619 to 3174968 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE phosphohexose mutase
IP Phosphoglucosamine mutase; Phosphoacetylglucosamine mutase
CL
EC
GO Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: magnesium ion binding (GO:0000287)
Molecular Function: phosphoglucosamine mutase activity (GO:0008966)
phosphotransferases (GO:0016868)
PM
AN
SQ 449 aa
 
........10........20........30........40........50
| | | | |
MSARKYFGTDGIRGRVGQGVISADFVLRLGNALGRVLTQGRSKRPLVLIG
KDTRISGYMFEAALEAGLVAAGADVQLIGPMPTPAIAFLTSTLRADAGVV
ISASHNPHYDNGIKFFSAEGEKLDDATEAAIEAALDEPFHTVESERLGKA
IRTRDAIGRYIEFCKASVARGFTLHGLKMVLDCAHGATYHIAPMLFRELG
AEVVVIGAAPDGLNINAGVGSTHIDNLAAKVRECGAHLGIAFDGDGDRVL
MADDQGNPVDGDDLLYVLARSWQASGRLTGTVVGTLMTNYGLEQALAALH
IPFQRAKVGDRYVHQALVEGGGTLGGETSGHLLCLDRASTGDGIVSALQV
LEALGRDRQSLRDALTSLSKVPQKTVNVRLDGGAAKAIVEAANVQQALQQ
AQAAVRGRGRAFLRPSGTEPVVRVTVEADDAGLMQDTLDRLSGAVRDAA
Hamap GLMM_MF_01554_B raw_score=11243 norm_score=44.669

Phosphoglucosamine mutase [glmM].

xansp

NP_643886.1 lcl|xanA-XAC3579

7

446

S=216 I=26 E=1.63497e-19

phosphoglucomutase

xansp

NP_644213.2 lcl|algC-XAC3912

12

269

S=202 I=31 E=8.78909e-18

phosphomannomutase

pubmed

1

446

S=1085 I=50 E=1.04648e-122

Phosphoglucosamine mutase EC=5.4.2.10 ; Isomerase Magnesium Metal-binding Phosphoprotein

Pubmed 8244950

 

prodomImg

pubmed

1

430

S=1069 I=53 E=1.04473e-120

Phosphoglucosamine mutase EC=5.4.2.10 ; Isomerase Magnesium Metal-binding Phosphoprotein

Pubmed 9079910

 

prodomImg

pubmed

6

449

S=958 I=46 E=3.12735e-107

Phosphoglucosamine mutase EC=5.4.2.10 ; Isomerase Magnesium Metal-binding Phosphoprotein

Pubmed 17344419

 

prodomImg

pubmed

6

446

S=954 I=45 E=8.74951e-107

Phosphoglucosamine mutase EC=5.4.2.10 ; Isomerase Magnesium Metal-binding Phosphoprotein

Pubmed 17303757

 

prodomImg

pubmed

1

447

S=939 I=44 E=6.2715e-105

Phosphoglucosamine mutase EC=5.4.2.10 ; Isomerase Magnesium Metal-binding Phosphoprotein

Pubmed 17468768

 

prodomImg

pubmed

5

430

S=929 I=44 E=1.0122e-103

Phosphoglucosamine mutase EC=5.4.2.10 ; Isomerase Magnesium Metal-binding Phosphoprotein

Pubmed 17493812

 

prodomImg

pubmed

2

431

S=773 I=41 E=6.44244e-85

Phosphoglucosamine mutase EC=5.4.2.10 ; Isomerase Magnesium Metal-binding Phosphoprotein

Pubmed 17965706

 

prodomImg

pubmed

5

446

S=739 I=39 E=1.01041e-80

Phosphoglucosamine mutase EC=5.4.2.10 ; Isomerase Magnesium Metal-binding Phosphoprotein

Pubmed 17218307

 

prodomImg

pubmed

7

447

S=697 I=41 E=1.21895e-75

Phosphoglucosamine mutase EC=5.4.2.10 ; Isomerase Magnesium Metal-binding Phosphoprotein

Pubmed 18218977

 

prodomImg

pubmed

5

446

S=689 I=36 E=9.96633e-75

Phosphoglucosamine mutase ; Isomerase Magnesium Metal-binding Phosphoprotein

Pubmed 18462386

 

prodomImg

sp

1

449

S=1988 I=87 E=0

Phosphoglucosamine mutase - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

sp

1

449

S=1919 I=85 E=0

Phosphoglucosamine mutase - Xanthomonas oryzae pv. oryzae

 

prodomImg

sp

1

449

S=1919 I=85 E=0

Phosphoglucosamine mutase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

sp

1

449

S=1909 I=84 E=0

Phosphoglucosamine mutase - Xanthomonas campestris pv. campestris

 

prodomImg

sp

1

449

S=1909 I=84 E=0

Phosphoglucosamine mutase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

trembl

1

449

S=1919 I=85 E=0

Phosphoglucosamine mutase - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

trembl

1

449

S=1909 I=84 E=0

Phosphoglucosamine mutase - Xanthomonas campestris pv. campestris (strain B100)

 

prodomImg

trembl

1

449

S=1585 I=69 E=0

Phosphoglucosamine mutase - Stenotrophomonas maltophilia R551-3

 

prodomImg

Iprscan IPR005841 [PR00509]

176

195

Alpha-D-phosphohexomutase, N-terminal

Iprscan IPR005841 [PR00509]

236

251

Alpha-D-phosphohexomutase, N-terminal

Iprscan IPR005841 [PR00509]

97

111

Alpha-D-phosphohexomutase, N-terminal

Iprscan IPR016055 [G3DSA:3.40.120.10]

178

252

Alpha-D-phosphohexomutase, alpha/beta/alpha I, II and III

Iprscan IPR016055 [G3DSA:3.40.120.10]

253

371

Alpha-D-phosphohexomutase, alpha/beta/alpha I, II and III

Iprscan IPR016055 [G3DSA:3.40.120.10]

4

150

Alpha-D-phosphohexomutase, alpha/beta/alpha I, II and III

Iprscan [PTHR22573]

64

446

-

Iprscan [PTHR22573:SF2]

64

446

-

Iprscan IPR005843 [PF00408]

407

447

Alpha-D-phosphohexomutase, C-terminal

Iprscan IPR005844 [PF02878]

4

142

Alpha-D-phosphohexomutase, alpha/beta/alpha domain I

Iprscan IPR005845 [PF02879]

158

258

Alpha-D-phosphohexomutase, alpha/beta/alpha domain II

Iprscan IPR005846 [PF02880]

260

371

Alpha-D-phosphohexomutase, alpha/beta/alpha domain III

Iprscan IPR006352 [TIGR01455]

7

447

Phosphoglucosamine mutase

Iprscan IPR016066 [PS00710]

98

107

Alpha-D-phosphohexomutase, conserved site

Iprscan IPR016055 [SSF53738]

157

259

Alpha-D-phosphohexomutase, alpha/beta/alpha I, II and III

Iprscan IPR016055 [SSF53738]

260

368

Alpha-D-phosphohexomutase, alpha/beta/alpha I, II and III

Iprscan IPR016055 [SSF53738]

4

183

Alpha-D-phosphohexomutase, alpha/beta/alpha I, II and III

Iprscan [SSF55957]

368

447

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one i6OKbkk3)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits