Xanthomonas axonopodis pv. citri str. 306

  1. XAC2676NP_642987.1hypothetical protein

XAC2676
XAC2675
XAC2675
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC2677
XAC2677
ID
AC NP_642987.1
LT XAC2676
SY
OR NC_003919 from 3135601 to 3135921 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE hypothetical protein
IP Glutaredoxin-related protein; Thioredoxin-like fold
CL
EC
GO Biological Process: cell redox homeostasis (GO:0045454)
Molecular Function: electron carrier activity (GO:0009055)
Molecular Function: protein disulfide oxidoreductase activity (GO:0015035)
PM
AN
SQ 106 aa
 
........10........20........30........40........50
| | | | |
MPVMERIQAEVEQHPIVLFMKGTPQFPMCEFSSRAVQALVAAGADQLRTV
NVLEEPEVRANLPRYSNWPTFPQLFIHGELIGGCDITLELFEAGELKRIV
SEAYQP
xansp

NP_643807.2 lcl|XAC3500-XAC3500

5

101

S=228 I=43 E=8.20984e-22

glutaredoxin-like protein

pubmed

1

103

S=295 I=47 E=4.33198e-28

Glutaredoxin-4 ; Cytoplasm Electron transport Redox-active center

Pubmed 9511768

 

prodomImg

pubmed

3

103

S=279 I=48 E=3.60118e-26

Glutaredoxin-like protein

Pubmed 12065505

 

prodomImg

pubmed

5

102

S=275 I=53 E=1.14829e-25

Monothiol glutaredoxin-S11 ; Cytoplasm Electron transport Redox-active center Repeat

Pubmed 12791992

 

prodomImg

pubmed

5

106

S=256 I=44 E=2.46909e-23

Monothiol glutaredoxin-S11 ; Cytoplasm Electron transport Redox-active center Repeat

Pubmed 12791992

 

prodomImg

pubmed

5

102

S=221 I=42 E=4.49112e-19

Monothiol glutaredoxin-S11 ; Cytoplasm Electron transport Redox-active center Repeat

Pubmed 12791992

 

prodomImg

pubmed

6

96

S=252 I=53 E=7.4069e-23

Putative uncharacterized protein

Pubmed 12904565

 

prodomImg

pubmed

5

103

S=252 I=51 E=7.53719e-23

Monothiol glutaredoxin-S14, chloroplastic ; Electron transport Plastid Redox-active center Transit peptide

Pubmed 12480930

 

prodomImg

pubmed

4

103

S=250 I=43 E=1.30545e-22

Probable monothiol glutaredoxin-2 ; Electron transport Redox-active center

Pubmed 9274032

 

prodomImg

pubmed

3

103

S=248 I=45 E=1.96664e-22

Putative glutaredoxin-like protein

Pubmed 15365646

 

prodomImg

pubmed

11

96

S=248 I=48 E=2.12718e-22

Glutaredoxin 5 homolog (S. cerevisiae) (Novel protein)

Pubmed 16110529

 

prodomImg

sp

3

102

S=317 I=50 E=5.81889e-31

Glutaredoxin-4 - Shigella flexneri

 

prodomImg

sp

3

102

S=317 I=50 E=5.81889e-31

Glutaredoxin-4 - Escherichia coli (strain K12)

Pubmed 7559321,15833738,15840565,

 

prodomImg

sp

3

102

S=317 I=50 E=5.81889e-31

Glutaredoxin-4 - Escherichia coli O6

 

prodomImg

sp

3

102

S=317 I=50 E=5.81889e-31

Glutaredoxin-4 - Escherichia coli O157:H7

 

prodomImg

sp

1

103

S=314 I=54 E=1.545e-30

Glutaredoxin-4 - Buchnera aphidicola subsp. Schizaphis graminum

 

prodomImg

trembl

1

106

S=558 I=100 E=5.51045e-59

Glutaredoxin-related protein precursor - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

106

S=548 I=97 E=8.22249e-58

Putative uncharacterized protein XCC2500 - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

1

106

S=548 I=97 E=8.22249e-58

Putative uncharacterized protein - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan IPR012335 [G3DSA:3.40.30.10]

3

100

Thioredoxin fold

Iprscan IPR014434 [PIRSF005894]

1

106

Monothiol glutaredoxin

Iprscan IPR004480 [PTHR10293]

5

104

Glutaredoxin-related protein

Iprscan IPR002109 [PF00462]

16

81

Glutaredoxin

Iprscan IPR004480 [TIGR00365]

3

103

Glutaredoxin-related protein

Iprscan IPR002109 [PS51354]

4

106

Glutaredoxin

Iprscan IPR012336 [SSF52833]

6

103

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one heNSHAmm)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits