Xanthomonas axonopodis pv. citri str. 306

  1. XAC2577gumJNP_642891.1GumJ protein

gumJ XAC2577
XAC2576
XAC2576
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC2578
XAC2578
ID gumJ
AC NP_642891.1
LT XAC2577
SY
OR NC_003919 from 3036283 to 3037794 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE GumJ protein
IP Polysaccharide biosynthesis protein
CL
EC
GO Biological Process: polysaccharide biosynthetic process (GO:0000271)
Cellular Component: membrane (GO:0016020)
PM
AN
SQ 503 aa
 
........10........20........30........40........50
| | | | |
MTAETPTMPSSTPPPPPQRSLGSRAAGGAAVTMLGQSAKMVVQFGGIILL
ARLLTPYDYGLMAMVTAIVGAAEILRDFGLSAAAVQAKQVSREQRDNLFW
INSGIGLALSLAVFASAHLIANFYKEPALVTISQALAVTFLINGMTTQYR
AHLSRGLRFGQVALSDVGSQVLGLGAAVAAALLGWGYWALVVQQVVQAGV
NFIIAASCARWLPGGYQRSAPMRDFMSFGWNLMAAQLLGYASRNVGQVII
GWRTGPDALGLYNRAFQLLMMPLNQINAPATSVALPVLSQLQDDRERFSA
FLLRGQTVMVHLIFALFAFACALAMPLIVLVLGEQWREAVPLFQVLTLGG
IFQTAAYATYWVFLARGLMRAQLVYSLVSRVLLIACIFVGSRWGAMGVAI
GYSFGLLLTWPLSLLWIGKISDAPVGALFTNALRAMVAYGVAGGCAYYAS
ITVGGPLWEQLAVGAVTMLAVCLLALAIWPAFRRDVIAIVNIRKLLTQAK
ARR
pubmed

19

503

S=1863 I=77 E=0

GumJ

Pubmed 7565082

 

prodomImg

pubmed

18

420

S=1629 I=81 E=0

GumJ

Pubmed 10940020

 

prodomImg

pubmed

41

384

S=322 I=27 E=3.96406e-30

Teichuronic acid biosynthesis protein tuaB ; Cell membrane wall biogenesis/degradation Stress response Transmembrane

Pubmed 10048024

 

prodomImg

pubmed

41

384

S=319 I=26 E=8.99646e-30

Putative uncharacterized protein tuaB

Pubmed 17928718

 

prodomImg

pubmed

49

402

S=304 I=22 E=6.33703e-28

Lipopolysaccharide biosynthesis protein wzxC ; Cell inner membrane Transmembrane

Pubmed 8759852

 

prodomImg

pubmed

49

402

S=285 I=21 E=1.14457e-25

Flippase (Putative export protein)

Pubmed 11004393

 

prodomImg

pubmed

40

402

S=285 I=22 E=1.27081e-25

Uncharacterized membrane protein in cps region ; Cell Exopolysaccharide synthesis Transmembrane

Pubmed 7896702

 

prodomImg

pubmed

34

402

S=251 I=22 E=1.53438e-21

Wzx

Pubmed 15109730

 

prodomImg

pubmed

34

367

S=246 I=22 E=5.29197e-21

O-antigen flippase

Pubmed 11598067

 

prodomImg

pubmed

34

367

S=245 I=22 E=8.62306e-21

Wzx

Pubmed 15774901

 

prodomImg

sp

41

384

S=322 I=27 E=2.49615e-30

Teichuronic acid biosynthesis protein tuaB - Bacillus subtilis

Pubmed 10048024,

 

prodomImg

sp

49

402

S=304 I=22 E=3.9904e-28

Lipopolysaccharide biosynthesis protein wzxC - Escherichia coli (strain K12)

Pubmed 8759852,

 

prodomImg

sp

40

402

S=285 I=22 E=8.00223e-26

Uncharacterized membrane protein in cps region - Klebsiella pneumoniae

Pubmed 7896702,

 

prodomImg

sp

32

348

S=137 I=21 E=6.91649e-08

Succinoglycan biosynthesis transport protein exoT - Rhizobium meliloti (Sinorhizobium meliloti)

Pubmed 8226645,8226646,8118055,11481431,

 

prodomImg

sp

80

384

S=132 I=20 E=2.22473e-07

Amylovoran biosynthesis protein amsL - Erwinia amylovora (Fire blight bacteria)

Pubmed 7596293,

 

prodomImg

trembl

1

503

S=2050 I=82 E=0

Xanthan biosynthesis oligosaccharidyl-lipid flippase GumJ - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

18

503

S=1970 I=81 E=0

GumJ protein - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

18

503

S=1970 I=81 E=0

GumJ protein - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Iprscan IPR002797 [PF01943]

25

292

Polysaccharide biosynthesis protein

Iprscan [tmhmm]

170

192

-

Iprscan [tmhmm]

310

332

-

Iprscan [tmhmm]

342

364

-

Iprscan [tmhmm]

371

393

-

Iprscan [tmhmm]

398

420

-

Iprscan [tmhmm]

432

451

-

Iprscan [tmhmm]

461

483

-

Iprscan [tmhmm]

98

120

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 5CxcZilD)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits