Xanthomonas axonopodis pv. citri str. 306

  1. XAC2501fruBNP_642816.1multiphosphoryl transfer protein

fruB XAC2501
XAC2500
XAC2500
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC2502
XAC2502
ID fruB
AC NP_642816.1
LT XAC2501
SY
OR NC_003919 from 2924373 to 2926889 on strand +
OS Xanthomonas axonopodis pv. citri str. 306
DE multiphosphoryl transfer protein
IP Phosphotransferase system, phosphocarrier HPr protein-like; Phosphotransferase system, PEP-utilising enzyme, N-terminal; Pyruvate/Phosphoenolpyruvate kinase, catalytic core; Phosphotransferase/anion transporter
CL
EC
GO Biological Process: phosphoenolpyruvate-dependent sugar phosphotransferase system (GO:0009401)
Biological Process: phosphorylation (GO:0016310)
Biological Process: transport (GO:0006810)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: transporter activity (GO:0005215)
Molecular Function: sugar:hydrogen symporter activity (GO:0005351)
Molecular Function: phosphoenolpyruvate-protein phosphotransferase activity (GO:0008965)
transferring phosphorus-containing groups (GO:0016772)
PM
AN
SQ 838 aa
 
........10........20........30........40........50
| | | | |
MSSPSPAPVTPDLVRLRASARDKDDAIAQAAQLLVAAGCVAPGYEASMRR
REGLANTFLGHGLAIPHGVGEDRHLVRRDGIAVLQLPDGVEWNPGQITRL
VVGIAAQSDTHITLLRRLTRLIQDPAQLEALFSTDDPSVIVAALTGDRAP
ETSAAPATDLAEAFEWTIAYPSGLHARPATRWAETARGFSARAQVRAGDQ
AADAKSLVGLLQLGLRAGDSITVSAEGSDAAELLKRLRAVMDSLTAQEKA
DAERAAQRRAAPVAGWTPPQAQPAIVGIGASPGVAIGIVHRLRAAQTEVA
DQPVGLGDGGAQLHDALTRTRQQLAAIQDDTQRRLGASDAAIFKAQAELL
NDTDLITRTCQLMVEGHGVAWSWHQAVEQIASGLAALGNPVLAGRAADLR
DVGRRVLAQLDPAAAGAGLTDLPDQPCILLASDLSPSDTANLDTARVLGL
ATAQGGPTSHTAILSRTLGLPALVAAGGQLLEIEDGVTAIIDGSSGRLYI
DPSEQDLDAARTHIAEQQAIREREAAQRALPAETTDGHHIDIGANVNLPD
QVAMALTQGAEGVGLMRTEFLFLESGRTPSEDEQHATYLAMAQALDGRPL
IVRALDIGGDKQVAHLELPHEENPFLGVRGARLLLRRPDLLEPQLRALYR
AAKDGARLSIMFPMITSVPELVALRAICARIRADLDAPEVPIGIMIEVPA
AAAQADVLARHADFFSIGTNDLTQYVLAIDRQNPELAAEADSLHPAVLRM
IRSTIEGARMHDRWVGVCGGLAGDAFGASLLAGLGVQELSMTPNDIPAVK
ARLRGAALSQLQQLAEQALACETAEQVRALEAKREDKA
xansp

NP_643288.1 lcl|ptsI-XAC2979

277

800

S=571 I=32 E=3.20259e-62

phosphotransferase system enzyme I

xansp

NP_642367.1 lcl|ppsA-XAC2041

657

796

S=146 I=28 E=1.03117e-10

phosphoenolpyruvate synthase

pubmed

1

838

S=3386 I=81 E=0

Multiphosphoryl transfer protein EC=2.7.3.9 EC=2.7.1.- ; Cytoplasm Kinase Phosphotransferase system Sugar transport

Pubmed 7496537

 

prodomImg

pubmed

8

799

S=1352 I=41 E=9.48507e-155

Multiphosphoryl transfer protein EC=2.7.3.9 EC=2.7.1.- ; Cytoplasm Kinase Phosphotransferase system Sugar transport

Pubmed 2193161

 

prodomImg

pubmed

277

800

S=872 I=35 E=1.56515e-96

Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) ; Cytoplasm Magnesium Metal-binding Phosphotransferase Sugar trans

Pubmed 15670601

 

prodomImg

pubmed

277

798

S=801 I=34 E=6.72646e-88

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 7686067

 

prodomImg

pubmed

272

796

S=788 I=35 E=2.57363e-86

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 7670643

 

prodomImg

pubmed

275

800

S=782 I=36 E=1.24711e-85

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 1655788

 

prodomImg

pubmed

275

800

S=778 I=36 E=3.97657e-85

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 2457575,2960675

 

prodomImg

pubmed

275

796

S=771 I=34 E=2.68382e-84

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 15590099

 

prodomImg

pubmed

275

796

S=756 I=33 E=1.57417e-82

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 1551842,1901791

 

prodomImg

pubmed

278

796

S=755 I=34 E=2.35088e-82

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 12855720

 

prodomImg

sp

1

838

S=3386 I=81 E=0

Multiphosphoryl transfer protein - Xanthomonas campestris pv. campestris

Pubmed 7496537,1655739,

 

prodomImg

sp

8

799

S=1352 I=41 E=5.97946e-155

Multiphosphoryl transfer protein - Rhodobacter capsulatus (Rhodopseudomonas capsulata)

Pubmed 2193161,

 

prodomImg

sp

275

798

S=823 I=35 E=8.6894e-91

Phosphoenolpyruvate-protein phosphotransferase - Bacillus halodurans

 

prodomImg

sp

275

796

S=811 I=34 E=2.16875e-89

Phosphoenolpyruvate-protein phosphotransferase - Bacillus megaterium

 

prodomImg

sp

277

798

S=801 I=34 E=4.24041e-88

Phosphoenolpyruvate-protein phosphotransferase - Bacillus subtilis

Pubmed 7686067,10568751,2497294,8449881,1495386,

 

prodomImg

trembl

1

838

S=3486 I=84 E=0

Multiphosphoryl transfer protein FruB - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

838

S=3419 I=83 E=0

Multiphosphoryl transfer protein - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

838

S=3418 I=83 E=0

Multiphosphoryl transfer protein - Xanthomonas oryzae pv. oryzae

 

prodomImg

Iprscan [PD000940]

544

798

-

Iprscan [PD001689]

15

134

-

Iprscan [PD002238]

171

241

-

Iprscan IPR005698 [PR00107]

173

189

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR005698 [PR00107]

198

213

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR005698 [PR00107]

213

230

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR006318 [PR01736]

564

583

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

713

728

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

730

745

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

766

778

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR008731 [G3DSA:1.10.274.10]

311

410

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR015813 [G3DSA:3.20.20.60]

521

830

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan IPR000032 [G3DSA:3.30.1340.10]

161

245

Phosphotransferase system, phosphocarrier HPr protein-like

Iprscan IPR002178 [G3DSA:3.40.930.10]

9

148

Phosphotransferase system, phosphoenolpyruvate-dependent sugar EIIA 2

Iprscan [PTHR22931]

275

830

-

Iprscan [PTHR22931:SF10]

275

830

-

Iprscan IPR002178 [PF00359]

7

147

Phosphotransferase system, phosphoenolpyruvate-dependent sugar EIIA 2

Iprscan IPR005698 [PF00381]

161

244

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR008279 [PF00391]

416

496

PEP-utilising enzyme, mobile region

Iprscan IPR000121 [PF02896]

521

808

PEP-utilizing enzyme

Iprscan IPR008731 [PF05524]

275

396

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR005698 [TIGR01003]

161

242

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR006318 [TIGR01417]

275

832

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR001020 [PS00369]

173

180

Phosphotransferase system, HPr histidine phosphorylation site

Iprscan IPR008279 [PS00370]

455

466

PEP-utilising enzyme, mobile region

Iprscan IPR002178 [PS00372]

52

68

Phosphotransferase system, phosphoenolpyruvate-dependent sugar EIIA 2

Iprscan IPR002114 [PS00589]

199

214

Phosphotransferase system, HPr serine phosphorylation site

Iprscan IPR000121 [PS00742]

713

731

PEP-utilizing enzyme

Iprscan IPR002178 [PS51094]

7

147

Phosphotransferase system, phosphoenolpyruvate-dependent sugar EIIA 2

Iprscan IPR000032 [PS51350]

161

253

Phosphotransferase system, phosphocarrier HPr protein-like

Iprscan IPR008731 [SSF47831]

292

413

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR015813 [SSF51621]

519

816

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan IPR008279 [SSF52009]

394

520

PEP-utilising enzyme, mobile region

Iprscan IPR000032 [SSF55594]

162

248

Phosphotransferase system, phosphocarrier HPr protein-like

Iprscan IPR016152 [SSF55804]

6

146

Phosphotransferase/anion transporter

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one JSZhNBam)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits