Xanthomonas axonopodis pv. citri str. 306

  1. XAC2372NP_642688.1IS1479 transposase

XAC2372
XAC2371
XAC2371
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC2373
XAC2373
ID
AC NP_642688.1
LT XAC2372
SY
OR NC_003919 from 2764923 to 2765189 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE IS1479 transposase
IP Transposase IS3/IS911
CL
EC
GO DNA-mediated (GO:0006313)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: transposase activity (GO:0004803)
PM
AN
SQ 88 aa
 
........10........20........30........40........50
| | | | |
MRTSKFTETQIIATLKQADAGVPVKDICRQVGISTATYYQWKSTYGGLEA
SELRRVKELESENAKLKRMYAELALDNAAMKDLIAKKL
xansp

NP_642916.1 lcl|XAC2603-XAC2603

1

88

S=440 I=97 E=1.16269e-47

ISxac4 transposase

xansp

NP_643810.1 lcl|XAC3503-XAC3503

5

88

S=402 I=92 E=3.89347e-43

ISxac4 transposase

xansp

NP_644779.1 lcl|XACb0051-XACb0051

1

87

S=268 I=54 E=7.78468e-27

ISxac2 transposase

xansp

NP_644742.1 lcl|XACb0014-XACb0014

1

87

S=266 I=54 E=1.2908e-26

ISxac2 transposase

xansp

NP_644690.1 lcl|XACa0004-XACa0004

1

87

S=266 I=54 E=1.2908e-26

ISxac2 transposase

xansp

NP_644245.1 lcl|XAC3944-XAC3944

1

87

S=266 I=54 E=1.2908e-26

ISxac2 transposase

xansp

NP_644071.1 lcl|XAC3764-XAC3764

1

87

S=266 I=54 E=1.2908e-26

ISxac2 transposase

xansp

NP_643591.1 lcl|XAC3283-XAC3283

1

87

S=266 I=54 E=1.2908e-26

ISxac2 transposase

xansp

NP_643199.1 lcl|XAC2890-XAC2890

1

87

S=266 I=54 E=1.2908e-26

ISxac2 transposase

pubmed

1

88

S=318 I=64 E=8.03949e-31

Transposase OrfA

Pubmed 9435062

 

prodomImg

pubmed

1

88

S=308 I=63 E=1.15851e-29

Transposase

Pubmed 17488332

 

prodomImg

pubmed

1

88

S=302 I=59 E=7.48533e-29

IS1400 transposase A

Pubmed 16902142

 

prodomImg

pubmed

1

88

S=294 I=57 E=5.80817e-28

Transposase 6

Pubmed 17049458

 

prodomImg

pubmed

1

88

S=279 I=55 E=4.02051e-26

Low calcium response locus protein S ; Plasmid

Pubmed 1577700

 

prodomImg

pubmed

1

88

S=279 I=55 E=4.02051e-26

Low calcium response locus protein S ; Plasmid

Pubmed 9746557,9748454

 

prodomImg

pubmed

1

87

S=276 I=55 E=9.20447e-26

Insertion element ISR1 uncharacterized 10 kDa protein A3 ; Transposable

Pubmed 2544911

 

prodomImg

pubmed

1

88

S=274 I=55 E=1.56666e-25

IS1400 transposase A

Pubmed 7607411,8955291

 

prodomImg

pubmed

1

87

S=257 I=53 E=1.67704e-23

Transposase ; Plasmid

Pubmed 16697042

 

prodomImg

pubmed

1

88

S=253 I=51 E=5.78397e-23

Putative transposase A

Pubmed 11150670

 

prodomImg

sp

1

88

S=279 I=55 E=2.3086e-26

Low calcium response locus protein S - Yersinia pseudotuberculosis

Pubmed 1577700,

 

prodomImg

sp

1

88

S=279 I=55 E=2.3086e-26

Low calcium response locus protein S - Yersinia pestis

Pubmed 9746557,9748454,

 

prodomImg

sp

1

87

S=276 I=55 E=5.28527e-26

Insertion element ISR1 uncharacterized 10 kDa protein A3 - Rhizobium sp.

Pubmed 2544911,

 

prodomImg

sp

5

87

S=245 I=52 E=2.96284e-22

Insertion element IS407 uncharacterized 10.0 kDa protein - Burkholderia cepacia (Pseudomonas cepacia)

 

prodomImg

trembl

1

88

S=329 I=66 E=3.09194e-31

ISXcc1 transposase ORFA - Xanthomonas campestris pv. campestris (strain B100)

 

prodomImg

trembl

1

88

S=328 I=66 E=3.68097e-31

ISxcc1 transposase - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

1

88

S=328 I=66 E=3.68097e-31

ISxcc1 transposase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan IPR002514 [PF01527]

3

80

Transposase IS3/IS911

Iprscan IPR009057 [SSF46689]

1

41

Homeodomain-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one yz8SbVZm)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits