Xanthomonas axonopodis pv. citri str. 306

  1. XAC2341gaaNP_642657.1glutaryl-7-ACA acylase precursor

gaa XAC2341
XAC2340
XAC2340
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC2342
XAC2342
ID gaa
AC NP_642657.1
LT XAC2341
SY
OR NC_003919 from 2734993 to 2736906 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE glutaryl-7-ACA acylase precursor
IP CocE/NonD hydrolase; Peptidase S15, Lactococcus X-Pro dipeptidyl-peptidase; Galactose-binding like
CL
EC
GO Biological Process: proteolysis (GO:0006508)
Biological Process: metabolic process (GO:0008152)
Molecular Function: dipeptidyl-peptidase activity (GO:0008239)
Molecular Function: hydrolase activity (GO:0016787)
Molecular Function: aminopeptidase activity (GO:0004177)
PM
AN
SQ 637 aa
 
........10........20........30........40........50
| | | | |
MRRLATCLLATAIAAASGSAWAQTSPMTPDITGKPFVAADASNDYIKREV
MIPMRDGVKLHTVIVLPKGAKNAPIVLTRTPYDASGRTERLASPHMKDLL
SAGDDVFVEGGYIRVFQDVRGKYGSEGDYVMTRPLRGPLNPSEVDHATDA
WDTIDWLVKNVSESNGKVGMIGSSYEGFTVVMALTNPHPALKVAVPESPM
IDGWMGDDWFNYGAFRQVNFDYFTGQLSKRGKGAGIARQGHDDYSNFLQA
GSAGDFAKAAGLEQLPWWHKLTEHAAYDAFWQEQALDKVMARTPLKVPTM
WLQGLWDQEDMWGAIHSYAAMEPRDKRNTLNYLVMGPWRHSQVNYDGSAL
GALNFEGDTARQFRHDVLRPFFDQYLVDGAPKADTPPVFIYNTGENHWDR
LKAWPRSCDKGCAATSKPLYLQAGGKLSFQPPVAGQAGFEEYVSDPAKPV
PFVPRPVDFADRAMWTTWLVHDQRFVDGRPDVLTFVTEPLTEPLQIAGAP
DVHLQASTSGSDSDWVVKLIDVYPEEMASNPKMGGYELPVSLAIFRGRYR
ESFSTPKPLTSNQPLAFQFGLPTANHTFQPGHRVMVQVQSSLFPLYDRNP
QTYVPNIFFAKPGDYQKATQRVYVSPEQPSYISLPVR
pubmed

1

637

S=3280 I=97 E=0

Glutaryl-7-ACA acylase

Pubmed 12387744

 

prodomImg

pubmed

30

636

S=1988 I=61 E=0

Alpha-amino acid ester hydrolase EC=3.1.1.43

Pubmed 11772629

 

prodomImg

pubmed

43

636

S=461 I=29 E=6.28828e-47

Cocaine esterase EC=3.1.1.- ; Cytoplasm Hydrolase

Pubmed 10698749,11742345

 

prodomImg

pubmed

46

636

S=388 I=29 E=4.72171e-38

Glutaryl 7-ACA acylase ; Signal

Pubmed 1744041

 

prodomImg

pubmed

472

636

S=178 I=32 E=1.39933e-12

7-beta-(4-carboxybutanamido)cephlosporanic acid acylase homolog

Pubmed 11157924

 

prodomImg

pubmed

295

605

S=174 I=28 E=4.05389e-12

Putative diester hydrolase

Pubmed 10650222

 

prodomImg

pubmed

46

196

S=141 I=30 E=3.86802e-08

Putative diester hydrolase

Pubmed 10650222

 

prodomImg

sp

43

636

S=461 I=29 E=3.98632e-47

Cocaine esterase - Rhodococcus sp. (strain MB1 Bresler)

Pubmed 10698749,11742345,12369817,

 

prodomImg

sp

331

591

S=126 I=26 E=1.90106e-06

Uncharacterized protein Mb1866c - Mycobacterium bovis

 

prodomImg

sp

331

591

S=126 I=26 E=1.90106e-06

Uncharacterized protein Rv1835c/MT1883 - Mycobacterium tuberculosis

 

prodomImg

trembl

1

637

S=3280 I=97 E=0

Alpha-amino acid ester hydrolase - Xanthomonas campestris pv. citri

 

prodomImg

trembl

26

637

S=3224 I=98 E=0

Putative alpha-amino acid ester hydrolase precursor - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

26

636

S=3192 I=97 E=0

Glutaryl-7-ACA acylase - Xanthomonas oryzae pv. oryzae

 

prodomImg

Iprscan [G3DSA:2.60.120.260]

400

637

-

Iprscan [G3DSA:3.40.50.1820]

11

402

-

Iprscan IPR000383 [PF02129]

56

342

Peptidase S15

Iprscan IPR013736 [PF08530]

369

633

Peptidase S15/CocE/NonD, C-terminal

Iprscan IPR005674 [TIGR00976]

52

637

CocE/NonD hydrolase

Iprscan [seg]

4

25

-

Iprscan [SignalP-NN(euk)]

1

22

-

Iprscan IPR008979 [SSF49785]

398

637

Galactose-binding like

Iprscan [SSF53474]

20

404

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one rqJ9JIZx)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits