Xanthomonas axonopodis pv. citri str. 306

  1. XAC2192NP_642509.1two-component system sensor protein

XAC2192
XAC2191
XAC2191
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC2193
XAC2193
ID
AC NP_642509.1
LT XAC2192
SY
OR NC_003919 from 2564613 to 2565662 on strand +
OS Xanthomonas axonopodis pv. citri str. 306
DE two-component system sensor protein
IP Fe(2+)-dicitrate sensor, transmembrane component
CL
EC
GO
PM
AN
SQ 349 aa
 
........10........20........30........40........50
| | | | |
MDSRQIEHAAAQWLARRESEPWDASDQLQLDAWLAQSTAHRVAFLRLEAA
WRETGRLSAIAAGLPRGGPPARGRFTGRALPAAARGKSAHARPASHAVQH
KRRWKLSLAVALAGGITIAGALFLDHAPSAQRQQAHAYQSPPGALRSLSL
ADGSRSTLGSDTRISVELGRHERHIALQRGEAFFEVAKDRHRPFVVQVGA
RRVVAVGTQFSVRRDADELRVVVTEGTVRLDADPKDGKPQPPVLVAAGGI
AVAGPHGVLVRSSTIAEAEQQVDWRSGYLSFTDAPLRDAVAEFNRFNTRP
LVLADAQLGELRIGGRFSWRNTEGFARLLEHSYPIRAESRAGQMILHAR
xansp

NP_644429.1 lcl|XAC4130-XAC4130

138

341

S=156 I=25 E=2.39563e-12

transmembrane sensor

pubmed

143

340

S=203 I=29 E=6.965e-16

FpvR

Pubmed 15743962

 

prodomImg

pubmed

143

340

S=202 I=29 E=7.66607e-16

FpvR

Pubmed 15743962

 

prodomImg

pubmed

145

340

S=201 I=30 E=1.21691e-15

FpvR

Pubmed 15743962

 

prodomImg

pubmed

135

232

S=124 I=33 E=2.0379e-06

Putative inner membrane sensor

Pubmed 11292812

 

prodomImg

trembl

137

349

S=260 I=30 E=5.31779e-22

Anti-FecI sigma factor, FecR - Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

 

prodomImg

trembl

133

346

S=248 I=32 E=1.73914e-20

Transcriptional regulator, putative - Oceanicaulis alexandrii HTCC2633

 

prodomImg

trembl

137

349

S=248 I=34 E=1.86477e-20

Probable transmembrane sensor - Pseudomonas aeruginosa (strain PA7)

 

prodomImg

Iprscan IPR012373 [PIRSF018266]

3

349

Fe(2+)-dicitrate sensor, transmembrane component

Iprscan IPR006860 [PF04773]

136

229

FecR protein

Iprscan [tmhmm]

106

124

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ONMqXbgw)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits