Xanthomonas axonopodis pv. citri str. 306

  1. XAC2041ppsANP_642367.1phosphoenolpyruvate synthase

ppsA XAC2041
XAC2040
XAC2040
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC2042
XAC2042
ID ppsA
AC NP_642367.1
LT XAC2041
SY pps
OR NC_003919 from 2385040 to 2387418 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE phosphoenolpyruvate synthase
IP Phosphoenolpyruvate synthase; Pyruvate/Phosphoenolpyruvate kinase, catalytic core
CL
EC
GO Biological Process: gluconeogenesis (GO:0006094)
Biological Process: phosphorylation (GO:0016310)
Molecular Function: kinase activity (GO:0016301)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: catalytic activity (GO:0003824)
transferring phosphorus-containing groups (GO:0016772)
water dikinase activity (GO:0008986)
PM
AN
SQ 792 aa
 
........10........20........30........40........50
| | | | |
MNENILWLHELRLADLARVGGKNSSLGEMIGNLAGLGVSVPGGYATTAEA
FKDFIAHNDLSKRIFDRLATLDVEDVNALTLAGKEIRGWVIDAPLQPDLD
RDIRSAYAQLCAENGGGDVAVAVRSSATAEDLPDASFAGQQETFLNVTGA
DDVVHKVKEVFASLYNDRAIAYRVHHGFKHEDVFLSAGVQLMVRSGVGAA
GVLFTLDTESGFRDVVFVTSSFGLGEMVVQGAVNPDEFYVYKPTLTAGKP
AILRRSLGSKAIRMVYSDVPGERVRTEDTPVELRSTFSISDEDVQELSKQ
ALVIEKHYGRPMDIEWAKDGVSGKLFIVQARPETVKSRSHATQIERFALE
AKGAKILAEGRAVGAKIGSGVARVVRSLDDMNRVQAGDVLIADMTDPDWE
PVMKRASAIVTNRGGRTCHAAIIARELGVPAVVGSGNATDVLSDGQEVTV
SCAEGDTGFIYDGLLPFERTTTDLGNMPPAPLKIMMNVANPERAFDFGQL
PNAGIGLARLEMIIAAHIGIHPNALLEYDKQDADVLKKIDAKIAGYGDPV
SFYVNRLAEGIATLTASVAPNTVIVRLSDFKSNEYANLIGGSRYEPHEEN
PMIGFRGASRYVDPSFTKAFALECKAVLKVRNEMGLDNLWVMIPFVRTLE
EGRKVIEVLEQNGLKQGENGLKIIMMCELPSNALLADEFLEIFDGFSIGS
NDLTQLTLGLDRDSSIVAHLFDERNPAVKKLLSMAIKSARAKGKYVGICG
QGPSDHPELAEWLMQEGIESVSLNPDTVVDTWLRLAKLKSEG
xansp

NP_643288.1 lcl|ptsI-XAC2979

598

781

S=210 I=30 E=2.01126e-18

phosphotransferase system enzyme I

xansp

NP_642816.1 lcl|fruB-XAC2501

596

785

S=185 I=29 E=2.13249e-15

multiphosphoryl transfer protein

pubmed

1

792

S=4099 I=97 E=0

Phosphoenolpyruvate synthase EC=2.7.9.2 ; Kinase Magnesium Metal-binding Transferase

Pubmed 16109965

 

prodomImg

pubmed

5

786

S=2809 I=66 E=0

Phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

Pubmed 17038831

 

prodomImg

pubmed

5

789

S=2777 I=65 E=0

Phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

Pubmed 1310524

 

prodomImg

pubmed

1

781

S=2055 I=50 E=0

Putative phosphoenolpyruvate synthase

Pubmed 17351032

 

prodomImg

pubmed

5

781

S=1581 I=44 E=0

Probable phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

Pubmed 7805870

 

prodomImg

pubmed

5

778

S=1077 I=38 E=1.83098e-121

Phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

Pubmed 7828869,7628701

 

prodomImg

pubmed

10

778

S=1066 I=37 E=4.15195e-120

Phosphoenolpyruvate synthase EC=2.7.9.2 ; Transferase

Pubmed 10430574

 

prodomImg

pubmed

510

787

S=1061 I=68 E=1.68997e-119

PpsA ; Kinase Magnesium Metal-binding Transferase

Pubmed 10438740

 

prodomImg

pubmed

291

528

S=849 I=68 E=7.74504e-94

Phosphoenolpyruvate synthase

Pubmed 17189443

 

prodomImg

pubmed

291

530

S=849 I=67 E=9.14044e-94

Phosphoenolpyruvate synthase

Pubmed 17189443

 

prodomImg

sp

5

786

S=2809 I=66 E=0

Phosphoenolpyruvate synthase - Neisseria meningitidis serogroup B

Pubmed 17038831,

 

prodomImg

sp

5

789

S=2777 I=65 E=0

Phosphoenolpyruvate synthase - Escherichia coli (strain K12)

Pubmed 1310524,4293109,4319237,16880,

 

prodomImg

sp

11

786

S=2599 I=65 E=0

Phosphoenolpyruvate synthase - Deinococcus radiodurans

 

prodomImg

sp

5

789

S=2285 I=55 E=0

Phosphoenolpyruvate synthase - Synechocystis sp. (strain PCC 6803)

 

prodomImg

sp

5

791

S=2244 I=53 E=0

Phosphoenolpyruvate synthase - Helicobacter pylori (Campylobacter pylori)

 

prodomImg

trembl

1

792

S=4118 I=98 E=0

Phosphoenolpyruvate synthase - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

792

S=4099 I=97 E=0

Phosphoenolpyruvate synthase - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

1

792

S=4099 I=97 E=0

Phosphoenolpyruvate synthase - Xanthomonas campestris pv. campestris (strain 8004)

Pubmed 16109965,

 

prodomImg

Iprscan [PD000940]

625

775

-

Iprscan IPR006318 [PR01736]

694

709

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

711

726

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

747

759

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR015813 [G3DSA:3.20.20.60]

480

789

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan IPR013815 [G3DSA:3.30.1490.20]

2

193

ATP-grasp fold, subdomain 1

Iprscan IPR008279 [G3DSA:3.50.30.10]

348

462

PEP-utilising enzyme, mobile region

Iprscan [PTHR22931]

8

784

-

Iprscan [PTHR22931:SF7]

8

784

-

Iprscan IPR008279 [PF00391]

377

458

PEP-utilising enzyme, mobile region

Iprscan IPR002192 [PF01326]

4

361

Pyruvate phosphate dikinase, PEP/pyruvate-binding

Iprscan IPR000121 [PF02896]

573

790

PEP-utilizing enzyme

Iprscan IPR006319 [TIGR01418]

4

790

Phosphoenolpyruvate synthase

Iprscan IPR008279 [PS00370]

414

425

PEP-utilising enzyme, mobile region

Iprscan IPR000121 [PS00742]

694

712

PEP-utilizing enzyme

Iprscan IPR015813 [SSF51621]

461

791

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan IPR008279 [SSF52009]

342

457

PEP-utilising enzyme, mobile region

Iprscan [SSF56059]

1

386

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one fgYOeTC6)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits