Xanthomonas axonopodis pv. citri str. 306

  1. XAC1992NP_642318.1c-di-GMP phosphodiesterase A

XAC1992
XAC1991
XAC1991
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC1994
XAC1994
ID
AC NP_642318.1
LT XAC1992
SY
OR NC_003919 from 2323230 to 2324951 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE c-di-GMP phosphodiesterase A
IP Cyclic nucleotide-binding; CheY-like; Oxygen sensor diguanylate cyclase/c-di-GMP phosphodiesterase
CL
EC
GO Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)
DNA-dependent (GO:0006355)
Molecular Function: two-component response regulator activity (GO:0000156)
PM
AN
SQ 573 aa
 
........10........20........30........40........50
| | | | |
MWSPVIPPGLEIVKPTRLGAGSPELLHLVDAAASGGPPLMIFHVDIDHFA
SINENMSGEVGDQALTLAARRLQEFLGARGKLWRHGSDEMVVVAVRRDDT
PLPEDFAEEIRQQLELPLSVLPYTLFMTGKVGISLCPEHSTSLSTLLDYA
EEASYQAAREGGNTVRLYTRNSATNAHSESIIARQIVDAIPHGELRLRYQ
PLVSARDGRIVGMEALLRWQSPTLGMLVPERFMRTAERLGVIVQIGEWVL
QNAVRQARLWRDQGFDDFSIAVNVSTLQLLRPGFFNEVMAMLQTAGVPAQ
FVTLEINESALTNNVNFVHETMANLRNEGISLSLDNFGTGDSSLSALVRY
PVDRLKIDRSFIKSAPAGSREAAIARAIIAMGHQLGMTVIANGVESQAQL
GFLRRNDCDIFQGYLFGEPMSAESAGMALRRRYLRPESFAESRPDRTLLL
LDDEENVLRSLVRLFRRDGYRILAAGNVRDAFDLLATNDVQVILSDQRMS
DMSGTEFLGRVKMLYPDTVRLVLSGYTDLATVTEAINRGAIYRFLTKPWN
DDELREHIRQAFRTHDELRNGRE
xansp

NP_642264.1 lcl|XAC1938-XAC1938

24

423

S=605 I=36 E=1.73488e-66

GGDEF family protein

xansp

NP_642698.1 lcl|XAC2382-XAC2382

27

421

S=577 I=35 E=4.06686e-63

GGDEF family protein

xansp

NP_643020.2 lcl|XAC2711-XAC2711

28

420

S=569 I=36 E=3.62804e-62

phosphodiesterase

xansp

NP_642320.2 lcl|XAC1993-XAC1993

36

430

S=539 I=35 E=1.769e-58

hypothetical protein

xansp

NP_642213.2 lcl|pdeA-XAC1887

28

422

S=530 I=33 E=2.29594e-57

c-di-GMP phosphodiesterase A

xansp

NP_642122.1 lcl|XAC1795-XAC1795

194

424

S=426 I=39 E=7.31139e-45

hypothetical protein

xansp

NP_643177.1 lcl|vieA-XAC2868

189

420

S=396 I=38 E=3.65945e-41

response regulator

xansp

NP_642469.1 lcl|XAC2152-XAC2152

183

423

S=351 I=33 E=1.162e-35

hypothetical protein

xansp

NP_644259.1 lcl|XAC3958-XAC3958

189

422

S=308 I=35 E=1.66889e-30

hypothetical protein

pubmed

420

573

S=769 I=98 E=2.67045e-84

Genes for sensor and regulator protein

Pubmed 2233675

 

prodomImg

pubmed

33

431

S=691 I=38 E=7.74568e-75

PA5017-like protein

Pubmed 17521365

 

prodomImg

pubmed

29

422

S=615 I=34 E=1.28588e-65

MorA

Pubmed 15489433

 

prodomImg

pubmed

40

423

S=576 I=33 E=7.13987e-61

Signaling protein ykoW ; Cell membrane Transmembrane

Pubmed 11728710

 

prodomImg

pubmed

35

423

S=573 I=34 E=1.51123e-60

C-di-GMP phosphodiesterase A

Pubmed 9721278

 

prodomImg

pubmed

15

423

S=572 I=32 E=2.33698e-60

ScrC

Pubmed 12374828

 

prodomImg

pubmed

32

431

S=571 I=34 E=2.85591e-60

PDEA1

Pubmed 15042328

 

prodomImg

pubmed

28

432

S=570 I=30 E=3.875e-60

YkoW protein

Pubmed 10589720

 

prodomImg

pubmed

32

431

S=568 I=34 E=6.04483e-60

C-di-GMP phosphodiesterase A

Pubmed 9721278

 

prodomImg

pubmed

35

420

S=554 I=34 E=3.13813e-58

C-di-GMP phosphodiesterase A

Pubmed 9721278

 

prodomImg

sp

36

448

S=638 I=35 E=1.29671e-68

Uncharacterized signaling protein PA3311 - Pseudomonas aeruginosa

 

prodomImg

sp

40

423

S=576 I=33 E=4.52439e-61

Signaling protein ykoW - Bacillus subtilis

Pubmed 11728710,

 

prodomImg

sp

41

423

S=573 I=34 E=9.24812e-61

Uncharacterized signaling protein PA1727 - Pseudomonas aeruginosa

 

prodomImg

sp

29

427

S=565 I=34 E=1.1097e-59

Uncharacterized signaling protein CC_0091 - Caulobacter crescentus (Caulobacter vibrioides)

 

prodomImg

sp

25

444

S=513 I=30 E=2.23737e-53

Uncharacterized protein Mb1389c - Mycobacterium bovis

 

prodomImg

trembl

1

573

S=2958 I=98 E=0

Putative two-component system sensor-response regulator hybrid protein - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

573

S=2942 I=97 E=0

C-di-GMP phosphodiesterase A - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

1

573

S=2942 I=97 E=0

C-di-GMP phosphodiesterase A - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan [PD000039]

447

563

-

Iprscan [G3DSA:3.30.70.270]

25

176

-

Iprscan [G3DSA:3.40.50.2300]

443

570

-

Iprscan [PTHR23283]

447

567

-

Iprscan [PTHR23283]

51

567

-

Iprscan [PTHR23283]

51

59

-

Iprscan [PTHR23283:SF21]

447

567

-

Iprscan [PTHR23283:SF21]

51

567

-

Iprscan [PTHR23283:SF21]

51

59

-

Iprscan IPR001789 [PF00072]

446

559

Signal transduction response regulator, receiver region

Iprscan IPR001633 [PF00563]

178

419

EAL

Iprscan IPR000160 [PF00990]

24

164

GGDEF

Iprscan IPR001633 [SM00052]

178

424

EAL

Iprscan IPR001789 [SM00448]

446

558

Signal transduction response regulator, receiver region

Iprscan IPR000160 [TIGR00254]

10

169

GGDEF

Iprscan IPR000595 [PS50042]

465

520

Cyclic nucleotide-binding

Iprscan IPR001789 [PS50110]

447

562

Signal transduction response regulator, receiver region

Iprscan IPR001633 [PS50883]

179

433

EAL

Iprscan IPR000160 [PS50887]

37

170

GGDEF

Iprscan IPR011006 [SSF52172]

443

570

CheY-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 1pMSpSIv)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits