Xanthomonas axonopodis pv. citri str. 306

  1. XAC1938NP_642264.1GGDEF family protein

XAC1938
XAC1937
XAC1937
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC1939
XAC1939
ID
AC NP_642264.1
LT XAC1938
SY
OR NC_003919 from 2265531 to 2267618 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE GGDEF family protein
IP MHYT; Oxygen sensor diguanylate cyclase/c-di-GMP phosphodiesterase
CL
EC
GO
PM
AN
SQ 695 aa
 
........10........20........30........40........50
| | | | |
MVGTYNPGMVMLSLVVAVLASYTALYLAARTTARGGGIAAAWLMGGAIAM
GIGIWSMHFVGMLAFRLPIPVGYDLALTCYSMLAAILTSALALWLTSRAN
LPLLRLGLGALLMGLGIALMHYMGMDALRMVPAIRYDPLLFGLSIAIAIG
ASGAALWIAFRLRHAGQRSSLRLIAASIMGVAIVGMHYTGMAAARFAPGS
VCGAVAETHLPLSWLTAVVVLVTLVLLMLALVISLLSRRFQQRTDVLAQS
LAKANAELALATLHDPLTRLPNRILLHEHLVQNIERAQRQGQRFAVMLIN
LDGFKVINDGYGHALGDRLLVVVAERLNAHRRAHGSLARLGADEFVLVAD
IADPEDAAALAAHLVQALAVPFLVANHELRLSSSIGIALYPEDAGSEHQL
LTHADAAMTHAKHAGRNRYSFFERSMTATTRDRLQLLQELPRALELGQFV
LHYQPKYCAEDGRPIGAEALIRWQHPERGLVPPDSFIPLAERSGMIGLLG
SWVLRQACRQMRDWRQAGHGDWRVAVNLSALQLASPSLLDEVATTLSEYA
LAPGQLTLEITETMAMRDAEACLRTLGQLNALGVRIAIDDFGTGYSNLLY
LRKLPAHELKIDRSFVQAMDGSAEDIAIVAAVVALAHTMRLQVVAEGVET
LAQRNTLERLGCDQLQGYLLGRPMDAERFIATVVAQRDGPRRLAS
xansp

NP_642213.2 lcl|pdeA-XAC1887

263

686

S=737 I=39 E=1.96019e-82

c-di-GMP phosphodiesterase A

xansp

NP_642320.2 lcl|XAC1993-XAC1993

253

695

S=680 I=39 E=1.73994e-75

hypothetical protein

xansp

NP_642698.1 lcl|XAC2382-XAC2382

247

685

S=642 I=35 E=7.50269e-71

GGDEF family protein

xansp

NP_643020.2 lcl|XAC2711-XAC2711

264

686

S=596 I=35 E=2.64513e-65

phosphodiesterase

xansp

NP_642318.1 lcl|XAC1992-XAC1992

279

677

S=529 I=32 E=3.44292e-57

c-di-GMP phosphodiesterase A

xansp

NP_642122.1 lcl|XAC1795-XAC1795

407

676

S=426 I=38 E=9.20951e-45

hypothetical protein

xansp

NP_643177.1 lcl|vieA-XAC2868

440

674

S=408 I=41 E=1.55132e-42

response regulator

xansp

NP_643121.1 lcl|XAC2812-XAC2812

257

682

S=400 I=29 E=1.4456e-41

hypothetical protein

xansp

NP_644259.1 lcl|XAC3958-XAC3958

430

681

S=399 I=38 E=1.84531e-41

hypothetical protein

pubmed

264

681

S=838 I=41 E=1.4295e-92

MorA

Pubmed 15489433

 

prodomImg

pubmed

253

686

S=742 I=37 E=6.34561e-81

Signaling protein ykoW ; Cell membrane Transmembrane

Pubmed 11728710

 

prodomImg

pubmed

56

196

S=156 I=28 E=8.04386e-10

Signaling protein ykoW ; Cell membrane Transmembrane

Pubmed 11728710

 

prodomImg

pubmed

263

677

S=741 I=38 E=8.76141e-81

YkoW protein

Pubmed 10589720

 

prodomImg

pubmed

247

686

S=708 I=36 E=9.61114e-77

Putative uncharacterized protein

Pubmed 16309397

 

prodomImg

pubmed

264

680

S=682 I=37 E=1.25623e-73

Putative uncharacterized protein RMe0348 (Diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(S)) ; Plasmid

Pubmed 7766206,11544228

 

prodomImg

pubmed

243

681

S=679 I=37 E=2.9522e-73

Multidomain signal-transduction protein

Pubmed 16436438

 

prodomImg

pubmed

265

691

S=666 I=37 E=1.23245e-71

Putative uncharacterized protein

Pubmed 14660379

 

prodomImg

pubmed

245

677

S=663 I=36 E=2.56352e-71

PA5017-like protein

Pubmed 17521365

 

prodomImg

pubmed

254

679

S=658 I=35 E=9.98922e-71

ScrC

Pubmed 12374828

 

prodomImg

sp

56

683

S=1449 I=48 E=1.04544e-166

Uncharacterized signaling protein PA1727 - Pseudomonas aeruginosa

 

prodomImg

sp

56

674

S=859 I=35 E=2.68533e-95

Uncharacterized signaling protein PA3311 - Pseudomonas aeruginosa

 

prodomImg

sp

253

686

S=742 I=37 E=3.9984e-81

Signaling protein ykoW - Bacillus subtilis

Pubmed 11728710,

 

prodomImg

sp

56

196

S=156 I=28 E=5.06847e-10

Signaling protein ykoW - Bacillus subtilis

Pubmed 11728710,

 

prodomImg

sp

264

673

S=712 I=39 E=2.00125e-77

Uncharacterized signaling protein CC_0091 - Caulobacter crescentus (Caulobacter vibrioides)

 

prodomImg

trembl

1

695

S=2664 I=77 E=0

Putative sensor protein - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

694

S=2431 I=71 E=0

GGDEF family protein - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

694

S=2431 I=71 E=0

Putative signal protein with GGDEF and EAL domains - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Iprscan [G3DSA:3.30.70.270]

253

430

-

Iprscan IPR001633 [PF00563]

432

673

EAL

Iprscan IPR000160 [PF00990]

258

418

GGDEF

Iprscan IPR005330 [PF03707]

114

175

MHYT

Iprscan IPR005330 [PF03707]

180

236

MHYT

Iprscan IPR005330 [PF03707]

4

44

MHYT

Iprscan IPR005330 [PF03707]

51

112

MHYT

Iprscan IPR001633 [SM00052]

432

678

EAL

Iprscan IPR000160 [SM00267]

251

422

GGDEF

Iprscan IPR000160 [TIGR00254]

258

423

GGDEF

Iprscan IPR001633 [PS50883]

433

687

EAL

Iprscan IPR000160 [PS50887]

292

424

GGDEF

Iprscan IPR005330 [PS50924]

5

197

MHYT

Iprscan [SignalP-NN(euk)]

1

20

-

Iprscan [tmhmm]

101

123

-

Iprscan [tmhmm]

10

28

-

Iprscan [tmhmm]

138

160

-

Iprscan [tmhmm]

172

194

-

Iprscan [tmhmm]

214

236

-

Iprscan [tmhmm]

35

57

-

Iprscan [tmhmm]

72

94

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one sX8jY2Ef)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits