Xanthomonas axonopodis pv. citri str. 306

  1. XAC1878rpfCNP_642204.1RpfC protein

rpfC XAC1878
XAC1877
XAC1877
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC1879
XAC1879
ID rpfC
AC NP_642204.1
LT XAC1878
SY
OR NC_003919 from 2179302 to 2181479 on strand +
OS Xanthomonas axonopodis pv. citri str. 306
DE RpfC protein
IP ATP-binding region, ATPase-like; Signal transduction histidine kinase, homodimeric; CheY-like; Signal transduction histidine kinase, hybrid-type, aerobic respiration control ArcB
CL
EC
GO Biological Process: peptidyl-histidine phosphorylation (GO:0018106)
Biological Process: signal transduction (GO:0007165)
Biological Process: phosphorylation (GO:0016310)
Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)
Cellular Component: membrane (GO:0016020)
DNA-dependent (GO:0006355)
Molecular Function: two-component response regulator activity (GO:0000156)
Molecular Function: signal transducer activity (GO:0004871)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: two-component sensor activity (GO:0000155)
Molecular Function: protein histidine kinase activity (GO:0004673)
transferring phosphorus-containing groups (GO:0016772)
PM
AN
SQ 725 aa
 
........10........20........30........40........50
| | | | |
MNPFARIRQTLMNRPDSEHGQAIVRIVLITLILSYVLLPHVRNSLPMHQY
TDVLAVVLVGLSLGLGLFVWLLSRPGRSDPRRIIGMLADYGLMAAGMVQM
GEPLAWVYVVVMWVTVGNGLRYGNRYLYLAVGMAVSSFATTLAMTEYWHE
NLSLGIGLAVGLAAVPLYFASLLRQLTRATVEARRASEAKSRFLANMSHE
FRTPLNGLSGMTEVLATTRMDSEQRECLKTIQASTRSLLALVEEVLDISA
IEAGKLRINTSDFALHDTLQAIGLILEPQSRAKALNYQVSVAADVPARLH
GDAGHLRQILLNLVGNAVKFTDQGSVQLKVAATGTNGRVGVLLRFEVIDT
GIGVPVDMRPRLFEAFEQADTGLARRFEGSGLGTTIAKGLVQSMGGAIGF
EENPEGGSQFWFELPFGLAAAVPASASLPALQDADTTAIPGNVIAFADPF
LRHRARVRSMQILVADDHLANRLVLQRLLQKAGHRVTCVDGGEAVLDALA
DTDYDAAIVDLHMPGVSGLDMLKQLRVMQAGGASVTQVVVLSADVTPESI
RSCEQAGAYAFLAKPVAAVKLLDTLAEIALNQKVRQTDAAIGKRGPATNG
AVLDPAVLDELAELGMGEEFEREFIQQCLSDATACVVELGKAAADEDWGR
LREHAHAVKGVSSNLGLVILAEQGGELMRLPEAQLRSEWRQRLEQLKTGL
AQGREALAQRARRKTEGGASGNGDP
xansp

NP_643980.1 lcl|XAC3673-XAC3673

121

577

S=563 I=32 E=2.88702e-61

histidine kinase

xansp

NP_640847.1 lcl|XAC0494-XAC0494

172

416

S=485 I=42 E=6.6754e-52

two-component system sensor protein

xansp

NP_640847.1 lcl|XAC0494-XAC0494

446

666

S=157 I=27 E=3.69517e-12

two-component system sensor protein

xansp

NP_643340.1 lcl|XAC3031-XAC3031

183

588

S=483 I=36 E=1.18682e-51

histidine kinase-response regulator hybrid protein

xansp

NP_641617.1 lcl|XAC1283-XAC1283

175

415

S=444 I=43 E=7.12781e-47

two-component system sensor protein

xansp

NP_642807.1 lcl|XAC2492-XAC2492

141

412

S=422 I=38 E=3.66517e-44

two-component system sensor protein

xansp

NP_642807.1 lcl|XAC2492-XAC2492

456

575

S=97 I=28 E=7.77561e-05

two-component system sensor protein

xansp

NP_643338.1 lcl|XAC3029-XAC3029

183

583

S=403 I=33 E=6.22795e-42

histidine kinase-response regulator hybrid protein

xansp

NP_643337.2 lcl|XAC3028-XAC3028

183

586

S=401 I=32 E=1.12675e-41

histidine kinase-response regulator hybrid protein

pubmed

30

712

S=2136 I=62 E=0

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 17574998

 

prodomImg

pubmed

2

720

S=1923 I=55 E=0

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 11123673

 

prodomImg

pubmed

74

710

S=1893 I=60 E=0

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 8810082

 

prodomImg

pubmed

74

720

S=1885 I=58 E=0

Sensory/regulatory protein rpfC EC=2.7.13.3 ; Cell inner membrane Kinase Phosphoprotein Transcription regulation Transferase Transmembrane Two-

Pubmed 1645442

 

prodomImg

pubmed

190

578

S=535 I=36 E=8.78104e-56

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 12855730

 

prodomImg

pubmed

175

580

S=522 I=32 E=3.79591e-54

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 16598018

 

prodomImg

pubmed

175

580

S=519 I=32 E=7.62494e-54

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 12107144

 

prodomImg

pubmed

175

414

S=505 I=43 E=3.65969e-52

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 10672185

 

prodomImg

pubmed

175

414

S=504 I=43 E=4.75379e-52

Signal transduction histidine-protein kinase barA EC=2.7.13.3 ; Cell inner membrane Phosphoprotein Transcription regulation Transferase Transmem

Pubmed 1574005

 

prodomImg

pubmed

175

414

S=495 I=43 E=6.44473e-51

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 9100385

 

prodomImg

sp

74

720

S=1887 I=58 E=0

Sensory/regulatory protein rpfC - Xanthomonas campestris pv. campestris

 

prodomImg

sp

74

720

S=1885 I=58 E=0

Sensory/regulatory protein rpfC - Xanthomonas campestris pv. campestris (strain 8004)

Pubmed 1645442,

 

prodomImg

sp

167

416

S=512 I=45 E=3.47629e-53

Hybrid signal transduction histidine kinase J - Dictyostelium discoideum (Slime mold)

 

prodomImg

sp

175

414

S=504 I=43 E=2.9949e-52

Signal transduction histidine-protein kinase barA - Escherichia coli (strain K12)

Pubmed 1574005,11022030,12193630,12533459,

 

prodomImg

sp

175

414

S=504 I=43 E=2.9949e-52

Signal transduction histidine-protein kinase barA - Escherichia coli O6

 

prodomImg

trembl

30

712

S=2136 I=62 E=0

Sensor protein - Stenotrophomonas maltophilia (Pseudomonas maltophilia) (Xanthomonas maltophilia)

Pubmed 17574998,

 

prodomImg

trembl

2

716

S=1961 I=56 E=0

Sensor protein - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

2

710

S=1944 I=56 E=0

Sensor protein - Xanthomonas oryzae pv. oryzae

 

prodomImg

Iprscan [PD000039]

460

575

-

Iprscan IPR004358 [PR00344]

343

357

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR004358 [PR00344]

361

371

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR004358 [PR00344]

378

396

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR004358 [PR00344]

402

415

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR003594 [G3DSA:3.30.565.10]

256

415

ATP-binding region, ATPase-like

Iprscan [G3DSA:3.40.50.2300]

453

588

-

Iprscan [PTHR23283]

179

428

-

Iprscan [PTHR23283]

461

584

-

Iprscan [PTHR23283]

5

13

-

Iprscan [PTHR23283]

5

584

-

Iprscan [PTHR23283:SF49]

179

428

-

Iprscan [PTHR23283:SF49]

461

584

-

Iprscan [PTHR23283:SF49]

5

13

-

Iprscan [PTHR23283:SF49]

5

584

-

Iprscan IPR001789 [PF00072]

460

576

Signal transduction response regulator, receiver region

Iprscan IPR003661 [PF00512]

189

254

Signal transduction histidine kinase, subgroup 1, dimerisation and phosphoacceptor region

Iprscan IPR008207 [PF01627]

623

699

Signal transduction histidine kinase, phosphotransfer (Hpt) region

Iprscan IPR003594 [PF02518]

301

417

ATP-binding region, ATPase-like

Iprscan IPR008207 [SM00073]

613

711

Signal transduction histidine kinase, phosphotransfer (Hpt) region

Iprscan IPR003594 [SM00387]

301

418

ATP-binding region, ATPase-like

Iprscan IPR003661 [SM00388]

189

254

Signal transduction histidine kinase, subgroup 1, dimerisation and phosphoacceptor region

Iprscan IPR001789 [SM00448]

460

575

Signal transduction response regulator, receiver region

Iprscan IPR005467 [PS50109]

196

418

Signal transduction histidine kinase, core

Iprscan IPR001789 [PS50110]

461

579

Signal transduction response regulator, receiver region

Iprscan IPR008207 [PS50894]

617

710

Signal transduction histidine kinase, phosphotransfer (Hpt) region

Iprscan [SignalP-NN(euk)]

1

38

-

Iprscan [tmhmm]

126

144

-

Iprscan [tmhmm]

151

173

-

Iprscan [tmhmm]

21

38

-

Iprscan [tmhmm]

53

73

-

Iprscan [tmhmm]

94

116

-

Iprscan IPR008207 [SSF47226]

597

715

Signal transduction histidine kinase, phosphotransfer (Hpt) region

Iprscan IPR009082 [SSF47384]

179

250

Signal transduction histidine kinase, homodimeric

Iprscan IPR011006 [SSF52172]

457

579

CheY-like

Iprscan IPR003594 [SSF55874]

243

416

ATP-binding region, ATPase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 7CGoguVY)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits