Xanthomonas axonopodis pv. citri str. 306

  1. XAC1757NP_642085.1bacterioferritin comigratory protein

XAC1757
XAC1756
XAC1756
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC1758
XAC1758
ID
AC NP_642085.1
LT XAC1757
SY
OR NC_003919 from 2015960 to 2016442 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE bacterioferritin comigratory protein
IP Thioredoxin-like fold
CL
EC
GO Biological Process: cell redox homeostasis (GO:0045454)
Molecular Function: antioxidant activity (GO:0016209)
Molecular Function: oxidoreductase activity (GO:0016491)
PM
AN
SQ 160 aa
 
........10........20........30........40........50
| | | | |
MTDAVFELPAATFDLPLALSGGTQTTLRDYAGKWLVLYFYPKDSTPGCTT
EGLDFNALLPQFKKAGAMVLGVSRDSVKSHDNFCAKQGFTFPLISDSDEA
LCRAFDVIKEKNMYGKQVLGIERSTFLLSPEGHVVLEWRKVKVAGHAEAV
LAAVKAHAKQ
xansp

NP_641259.1 lcl|ahpC-XAC0907

24

132

S=122 I=37 E=1.25646e-08

alkyl hydroperoxide reductase subunit C

pubmed

9

141

S=389 I=59 E=4.50892e-39

AHP/TSA peroxiredoxin

Pubmed 18492059

 

prodomImg

pubmed

14

141

S=349 I=52 E=3.73889e-34

Bacterioferritin comigratory protein

Pubmed 12446909

 

prodomImg

pubmed

6

141

S=323 I=46 E=5.10468e-31

Bacterioferritin comigratory protein

Pubmed 11319266

 

prodomImg

pubmed

6

141

S=321 I=46 E=8.53832e-31

Bacterioferritin comigratory protein

Pubmed 11319266

 

prodomImg

pubmed

10

141

S=305 I=46 E=7.61066e-29

Putative peroxiredoxin bcp EC=1.11.1.15 ; Oxidoreductase Peroxidase Redox-active center

Pubmed 17088354

 

prodomImg

pubmed

10

132

S=236 I=40 E=1.95547e-20

Bacterioferritin comigratory protein homolog

Pubmed 9293000

 

prodomImg

pubmed

10

134

S=224 I=38 E=4.8382e-19

Putative peroxiredoxin bcp EC=1.11.1.15 ; Oxidoreductase Peroxidase Redox-active center

Pubmed 2016588

 

prodomImg

pubmed

9

128

S=201 I=37 E=2.69092e-16

Bcp

Pubmed 12055304

 

prodomImg

pubmed

10

134

S=195 I=35 E=1.63571e-15

Putative peroxiredoxin bcp EC=1.11.1.15 ; Oxidoreductase Peroxidase Redox-active center

Pubmed 9767718

 

prodomImg

pubmed

22

138

S=179 I=38 E=1.34796e-13

Peroxiredoxin Q, chloroplastic EC=1.11.1.15 ; Antioxidant Oxidoreductase Peroxidase Plastid Redox-active center Transit peptide

Pubmed 10998352

 

prodomImg

sp

10

141

S=305 I=46 E=4.85837e-29

Putative peroxiredoxin bcp - Coxiella burnetii

Pubmed 17088354,

 

prodomImg

sp

14

137

S=266 I=43 E=2.62798e-24

Putative peroxiredoxin bcp - Helicobacter pylori J99 (Campylobacter pylori J99)

 

prodomImg

sp

14

137

S=264 I=42 E=4.92323e-24

Putative peroxiredoxin bcp - Helicobacter pylori (Campylobacter pylori)

 

prodomImg

sp

10

134

S=224 I=38 E=3.08853e-19

Putative peroxiredoxin bcp - Shigella flexneri

 

prodomImg

sp

10

134

S=224 I=38 E=3.08853e-19

Putative peroxiredoxin bcp - Escherichia coli (strain K12)

Pubmed 2016588,9537378,10644761,

 

prodomImg

trembl

1

141

S=726 I=96 E=4.55223e-79

Putative AhpC/TSA family peroxiredoxin - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

141

S=721 I=95 E=1.80506e-78

Bacterioferritin comigratory protein - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

141

S=721 I=95 E=1.80506e-78

Bacterioferritin comigratory protein - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Iprscan IPR012335 [G3DSA:3.40.30.10]

4

157

Thioredoxin fold

Iprscan [PTHR10681]

22

156

-

Iprscan [PTHR10681:SF5]

22

156

-

Iprscan IPR000866 [PF00578]

6

137

Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen

Iprscan IPR017936 [PS51352]

4

159

Thioredoxin-like

Iprscan IPR012336 [SSF52833]

6

156

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one m1LNBGgS)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits