Xanthomonas axonopodis pv. citri str. 306

  1. XAC1741recXNP_642072.1recombination regulator RecX

recX XAC1741
XAC1740
XAC1740
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC1742
XAC1742
ID recX
AC NP_642072.1
LT XAC1741
SY
OR NC_003919 from 2001237 to 2001725 on strand +
OS Xanthomonas axonopodis pv. citri str. 306
DE recombination regulator RecX
IP Regulatory protein RecX
CL
EC
GO Biological Process: regulation of DNA repair (GO:0006282)
PM
AN
SQ 162 aa
 
........10........20........30........40........50
| | | | |
MDEQEPAPKRGRRFKEQTPVQRALGLLVRREHSRKELNRKLLARGIEPDA
AQAAVDRLTDEGWQDDTRFAAAVVRNRAGSGYGPLHIRAELGTHGLDSEA
ISAALAAFEGDWTENARDLIRRRFGEQGPTDLPQRRKAADLLARRGFEGN
SIRAATRFDLED
Hamap RECX_MF_01114 raw_score=1996 norm_score=15.276

Regulatory protein recX [recX].

pubmed

1

162

S=822 I=100 E=1.74641e-91

Regulatory protein recX ; Cytoplasm

Pubmed 11178726

 

prodomImg

pubmed

1

162

S=777 I=94 E=4.53782e-86

Regulatory protein recX ; Cytoplasm

Pubmed 11728720,12007798

 

prodomImg

pubmed

1

162

S=727 I=87 E=6.45532e-80

Regulatory protein recX ; Cytoplasm

Pubmed 12007798

 

prodomImg

pubmed

23

152

S=237 I=43 E=1.3825e-20

Regulatory protein recX ; Cytoplasm

Pubmed 8165147

 

prodomImg

pubmed

23

162

S=237 I=42 E=1.52166e-20

Regulatory protein recX ; Cytoplasm

Pubmed 11053404

 

prodomImg

pubmed

18

152

S=233 I=42 E=3.70288e-20

Regulatory protein recX ; Cytoplasm

Pubmed 8468303

 

prodomImg

pubmed

18

131

S=226 I=45 E=3.21805e-19

Regulatory protein recX ; Cytoplasm

Pubmed 8294013,8165147

 

prodomImg

pubmed

23

152

S=191 I=35 E=4.91679e-15

Regulatory protein recX ; Cytoplasm

Pubmed 11251842,2121588

 

prodomImg

pubmed

20

157

S=184 I=34 E=3.65239e-14

Regulatory protein recX ; Cytoplasm DNA damage repair SOS response

Pubmed 7512687

 

prodomImg

pubmed

22

155

S=160 I=38 E=2.59308e-11

Regulatory protein recX ; Cytoplasm

Pubmed 12718403

 

prodomImg

sp

1

162

S=822 I=100 E=1.11398e-91

Regulatory protein recX - Xanthomonas campestris pv. citri

Pubmed 11178726,

 

prodomImg

sp

1

162

S=811 I=98 E=2.73228e-90

Regulatory protein recX - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

sp

1

162

S=777 I=94 E=2.89454e-86

Regulatory protein recX - Xanthomonas oryzae pv. oryzae

Pubmed 11728720,12007798,

 

prodomImg

sp

1

159

S=762 I=94 E=1.90153e-84

Regulatory protein recX - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

sp

1

162

S=727 I=87 E=4.11766e-80

Regulatory protein recX - Xanthomonas campestris pv. campestris

Pubmed 12007798,

 

prodomImg

trembl

1

162

S=777 I=94 E=3.05714e-85

Regulatory protein RecX - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

trembl

1

162

S=727 I=87 E=4.34896e-79

Regulatory protein RecX - Xanthomonas campestris pv. campestris (strain B100)

 

prodomImg

trembl

1

162

S=602 I=74 E=6.03419e-64

Putative RecX regulatory protein - Stenotrophomonas maltophilia (strain K279a)

 

prodomImg

Iprscan IPR003783 [PF02631]

41

161

Regulatory protein RecX

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one f3P52UIA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits