Xanthomonas axonopodis pv. citri str. 306

  1. XAC1516smpANP_641849.1outer membrane protein

smpA XAC1516
XAC1515
XAC1515
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC1517
XAC1517
ID smpA
AC NP_641849.1
LT XAC1516
SY
OR NC_003919 from 1750349 to 1750744 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE outer membrane protein
IP SmpA/OmlA
CL
EC
GO Cellular Component: outer membrane (GO:0019867)
PM
AN
SQ 131 aa
 
........10........20........30........40........50
| | | | |
MRNLLLVAAVALSTAGCGIIYKQPIYQGNLIKQNAVEQLQVGQSKQQVSA
LLGTPSIPDPFHAQRWDYTSTQRVDRLARTEIKNFTVFFENEQVVRWEGD
YFPSQDEQLAKAAPKQFGRNLARDKKKQRGR
pubmed

1

131

S=597 I=88 E=1.96517e-64

Outer membrane lipoprotein A

Pubmed 10548726

 

prodomImg

pubmed

21

110

S=175 I=38 E=2.86191e-13

Outer membrane lipoprotein

Pubmed 11320133

 

prodomImg

pubmed

21

105

S=166 I=38 E=2.98694e-12

Outer membrane lipoprotein

Pubmed 11320133

 

prodomImg

pubmed

13

109

S=166 I=36 E=3.23076e-12

Outer membrane lipoprotein omlA ; Cell Palmitate Signal

Pubmed 9973334

 

prodomImg

pubmed

20

109

S=149 I=35 E=3.42835e-10

Outer membrane lipoprotein omlA ; Cell Palmitate Signal

Pubmed 9973334

 

prodomImg

sp_Pdown

O68564|OMLA_PSEFL

13

109

S=166 I=36 E=2.08991e-12

Outer membrane lipoprotein omlA precursor - Pseudomonas fluorescens

sp_Pdown

O68562|OMLA_PSEAE

20

109

S=149 I=35 E=2.21773e-10

Outer membrane lipoprotein omlA precursor - Pseudomonas aeruginosa

sp_Pdown

P0A939|SMPA_SHIFL

14

95

S=128 I=35 E=7.77033e-08

Small protein A precursor - Shigella flexneri

sp_Pdown

P0A937|SMPA_ECOLI

14

95

S=128 I=35 E=7.77033e-08

Small protein A precursor - Escherichia coli (strain K12)

sp_Pdown

P0A938|SMPA_ECOL6

14

95

S=128 I=35 E=7.77033e-08

Small protein A precursor - Escherichia coli O6

trembl_Pdown

Q3BVC3|Q3BVC3_XANC5

1

131

S=641 I=92 E=6.36428e-69

Putative outer membrane protein precursor - Xanthomonas campestris pv. vesicatoria (strain 85-10)

trembl_Pdown

Q5H191|Q5H191_XANOR

1

131

S=631 I=90 E=9.41412e-68

Outer membrane protein - Xanthomonas oryzae pv. oryzae

trembl_Pdown

Q2P464|Q2P464_XANOM

1

131

S=631 I=90 E=9.41412e-68

Outer membrane protein - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

Iprscan IPR007450 [PF04355]

17

99

SmpA/OmlA

Iprscan [PS51257]

1

17

-

Iprscan [SignalP-NN(euk)]

1

18

-

Iprscan [tmhmm]

4

21

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one zSk6tx6k)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits