Xanthomonas axonopodis pv. citri str. 306

  1. XAC1149NP_641485.1bacterioferritin

XAC1149
XAC1148
XAC1148
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC1150
XAC1150
ID
AC NP_641485.1
LT XAC1149
SY
OR NC_003919 from 1310385 to 1310945 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE bacterioferritin
IP Ferritin and Dps; Ferritin/ribonucleotide reductase-like
CL
EC
GO Biological Process: cellular iron ion homeostasis (GO:0006879)
Molecular Function: ferric iron binding (GO:0008199)
Molecular Function: transition metal ion binding (GO:0046914)
Molecular Function: oxidoreductase activity (GO:0016491)
PM
AN
SQ 186 aa
 
........10........20........30........40........50
| | | | |
MSDQPATNTPAGITDTATLRARARQSIEDGAITESYHADREKVIELLNTA
LATEYVCTLRYYRHYFMAKGMLADAVKGEFLEHAQQEQEHAHKLAERIVQ
LGGEPDLNPDTLTKRSHAEYKEGTDLRDMVKENLIAERIAIDSYREMIDF
IGDQDTTTKRILESILAQEEEHADEFADMLEGWIGE
xansp

NP_640846.1 lcl|bfr-XAC0493

42

174

S=121 I=32 E=1.66629e-08

bacterioferritin

pubmed

42

180

S=133 I=32 E=7.38023e-08

DNA protection during starvation protein EC=1.16.-.- ; condensation DNA-binding Heme Iron storage Metal-binding Oxidoreductase

Pubmed 7673237,7794101

 

prodomImg

pubmed

42

180

S=133 I=32 E=7.38023e-08

Nutrient stress-induced DNA-binding protein ; Heme Iron Metal-binding

Pubmed 10411274

 

prodomImg

pubmed

42

174

S=129 I=31 E=2.3739e-07

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 8674981,11752777

 

prodomImg

pubmed

41

176

S=127 I=31 E=3.80131e-07

Nutrient-stress induced DNA binding protein (Ferritin and Dps)

Pubmed 16597998

 

prodomImg

pubmed

41

182

S=126 I=29 E=4.81026e-07

Ferritin (Non-heme iron-containing protein)

Pubmed 11772643

 

prodomImg

pubmed

39

182

S=124 I=33 E=8.04586e-07

DNA protection during starvation protein EC=1.16.-.- ; Cytoplasm DNA-binding Iron storage Metal-binding Oxidoreductase

Pubmed 16412514

 

prodomImg

pubmed

40

174

S=118 I=29 E=5.29002e-06

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 16980464

 

prodomImg

pubmed

42

181

S=115 I=29 E=1.03519e-05

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 12897839

 

prodomImg

pubmed

42

174

S=112 I=30 E=2.65437e-05

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 7698330

 

prodomImg

sp

42

180

S=133 I=32 E=4.68164e-08

DNA protection during starvation protein - Synechococcus sp. (strain PCC 7942) (Anacystis nidulans R2)

 

prodomImg

sp

42

180

S=133 I=32 E=4.68164e-08

Nutrient stress-induced DNA-binding protein - Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)

Pubmed 10411274,

 

prodomImg

sp

42

174

S=129 I=31 E=1.50588e-07

Bacterioferritin - Rhodobacter capsulatus (Rhodopseudomonas capsulata)

Pubmed 8674981,11752777,

 

prodomImg

sp

39

182

S=124 I=33 E=5.10388e-07

DNA protection during starvation protein - Pyrococcus furiosus

Pubmed 16412514,

 

prodomImg

sp

42

174

S=116 I=31 E=4.96796e-06

Bacterioferritin - Brucella suis

 

prodomImg

trembl

1

186

S=972 I=99 E=1.15139e-108

Putative bacterioferritin - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

186

S=934 I=96 E=4.67087e-104

Bacterioferritin - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

1

186

S=934 I=96 E=4.67087e-104

Bacterioferritin - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan [PD002269]

37

105

-

Iprscan IPR012347 [G3DSA:1.20.1260.10]

32

180

Ferritin-related

Iprscan IPR014490 [PIRSF018063]

13

186

Uncharacterised conserved protein UCP018063, ferritin fold

Iprscan IPR008331 [PF00210]

44

181

Ferritin and Dps

Iprscan IPR009040 [PS50905]

37

186

Ferritin-like

Iprscan IPR009078 [SSF47240]

29

181

Ferritin/ribonucleotide reductase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one hCRscVKH)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits