Xanthomonas axonopodis pv. citri str. 306

  1. XAC1094opsXNP_641432.1saccharide biosynthesis regulatory protein

opsX XAC1094
XAC1093
XAC1093
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC1095
XAC1095
ID opsX
AC NP_641432.1
LT XAC1094
SY
OR NC_003919 from 1247218 to 1248267 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE saccharide biosynthesis regulatory protein
IP Glycosyl transferase, family 9
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: transferase activity (GO:0016740)
PM
AN
SQ 349 aa
 
........10........20........30........40........50
| | | | |
MAVTPASLCLLRLSALGDVTHVVPLVRTLQAGFPETQLHWIIDRAGLKLL
DGLPGVQFHAYDKRSGVAGMRALRRSLAPLGRFDALLQMQVALRANVLSA
FVPARRRIGYDRSRSKDLHGLFVNERIADRPGIHVLDAIGSFAEPLGLRQ
TQVRWDLPVPDEAHTWARAQWDDDGRPVLMISPCSSHARRNWYPDRHAAL
ADHAAAQGWRIVLCGGRSDLERSTADAIVAAARTPVLDLVGKDTLKQLPA
LLARANLVVTPDSGPMHIANAMGTKVLGLHAASNPRRSGPYSDVRYCVDR
YDAAARKFLQKPADQLSWGTKIEFDEVMSLITVDDAIAAFERYRADHRR
pubmed

70

349

S=1258 I=88 E=1.00679e-143

DNA, complete cds

Pubmed 8376331

 

prodomImg

pubmed

5

346

S=638 I=40 E=1.36387e-68

WaaC

Pubmed 18310345

 

prodomImg

pubmed

102

342

S=422 I=34 E=1.56135e-42

Lipopolysaccharide biosynthesis protein

Pubmed 17185550

 

prodomImg

pubmed

102

250

S=228 I=33 E=5.42251e-19

Heptosyl transferase

Pubmed 12797973

 

prodomImg

pubmed

102

250

S=228 I=32 E=5.91651e-19

Heptosyl transferase

Pubmed 12797973

 

prodomImg

pubmed

102

250

S=228 I=32 E=6.12649e-19

Heptosyl transferase

Pubmed 12797973

 

prodomImg

pubmed

102

250

S=228 I=32 E=6.12649e-19

Heptosyl transferase

Pubmed 12797973

 

prodomImg

pubmed

102

250

S=228 I=32 E=6.34392e-19

Heptosyl transferase

Pubmed 12797973

 

prodomImg

pubmed

102

250

S=226 I=32 E=8.99121e-19

Heptosyl transferase

Pubmed 12797973

 

prodomImg

pubmed

102

250

S=226 I=32 E=1.0704e-18

Heptosyl transferase

Pubmed 12797973

 

prodomImg

sp

5

342

S=630 I=36 E=6.83889e-68

Putative glycosyltransferase HI0261 - Haemophilus influenzae

 

prodomImg

sp

17

293

S=169 I=23 E=4.52525e-12

Lipopolysaccharide core biosynthesis glycosyltransferase rfaQ - Escherichia coli (strain K12)

Pubmed 1732225,1447141,8041620,

 

prodomImg

sp

176

293

S=116 I=27 E=1.339e-05

ADP-heptose--LPS heptosyltransferase 2 - Haemophilus influenzae

 

prodomImg

sp

14

292

S=109 I=24 E=9.037e-05

ADP-heptose--LPS heptosyltransferase 2 - Escherichia coli (strain K12)

Pubmed 8041620,2198271,8478319,

 

prodomImg

trembl

1

349

S=1659 I=92 E=0

Saccharide biosynthesis regulatory protein - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

349

S=1657 I=91 E=0

Saccharide biosynthesis regulatory protein - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

10

349

S=1609 I=91 E=0

Heptosyl transferase, glycosyltransferase family 9 protein - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Iprscan [G3DSA:3.40.50.2000]

159

341

-

Iprscan [G3DSA:3.40.50.2000]

7

111

-

Iprscan IPR002201 [PF01075]

70

319

Glycosyl transferase, family 9

Iprscan [SignalP-NN(euk)]

1

17

-

Iprscan [SSF53756]

7

342

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one oabvlluL)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits