Xanthomonas axonopodis pv. citri str. 306

  1. XAC1011NP_641358.1oxidoreductase

XAC1011
XAC1010
XAC1010
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC1012
XAC1012
ID
AC NP_641358.1
LT XAC1011
SY
OR NC_003919 from 1167056 to 1168078 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE oxidoreductase
IP Alcohol dehydrogenase superfamily, zinc-containing; NAD(P)-binding
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: binding (GO:0005488)
Molecular Function: zinc ion binding (GO:0008270)
PM
AN
SQ 340 aa
 
........10........20........30........40........50
| | | | |
MKAVALTRHLPIDDPESLLDVELPAPAAPSGYDLLVRVEAISVNPVDTKV
RAPKPQPLQAPKVLGYDAAGVIEAVGPEVTAFAVGDEVYYAGDIGRPGSN
AQYQLVDARIAGCKPTSLSFAQAAALPLTTLTAWELLFQRMPYSFDGARN
RGRHLLIVGGAGGVGSIAIQLARHAGFTVIATASRPESIEWVRQMGAHHV
IDHHQPLQPQLQALGLETVDAALNLADTDRYWQPLGEVLAPQGHVGLIVE
PRGPLSIGDPYKSKCIGIHWELMFTRARYATEDMVEQHRILNRAASLIDA
GELRTTHTETLSPINAQQLREAHRRLESGSTIGKLVLAGW
xansp

NP_644643.1 lcl|XAC4349-XAC4349

1

340

S=650 I=45 E=3.57679e-72

alginate lyase

xansp

NP_641146.1 lcl|XAC0794-XAC0794

14

337

S=127 I=27 E=7.97485e-09

quinone reductase

xansp

NP_643205.1 lcl|XAC2896-XAC2896

17

88

S=116 I=44 E=1.4798e-07

alcohol dehydrogenase

xansp

NP_644054.1 lcl|ybdR-XAC3747

23

88

S=94 I=35 E=8.52244e-05

Zn-dependent alcohol dehydrogenase

pubmed

1

340

S=639 I=43 E=8.65624e-69

Putative zinc-binding dehydrogenase

Pubmed 15574953

 

prodomImg

pubmed

1

337

S=473 I=34 E=1.02233e-48

Zinc-type alcohol dehydrogenase-like protein SA1988 ; Metal-binding Oxidoreductase

Pubmed 15590099

 

prodomImg

pubmed

15

337

S=190 I=31 E=2.17794e-14

Putative oxidoreductase

Pubmed 10627032

 

prodomImg

pubmed

29

200

S=186 I=37 E=6.30958e-14

Glycosyl hydrolase

Pubmed 17086451

 

prodomImg

pubmed

22

337

S=186 I=27 E=7.6437e-14

Predicted zinc-binding oxidoreductase

Pubmed 9434161,10094695

 

prodomImg

pubmed

36

337

S=167 I=26 E=1.36859e-11

2-haloacrylate reductase

Pubmed 15781461

 

prodomImg

pubmed

8

257

S=164 I=28 E=3.13323e-11

Zeta-crystallin ; Cytoplasm DNA-binding

Pubmed 9154917

 

prodomImg

pubmed

1

202

S=159 I=28 E=1.13866e-10

Zeta-crystallin

Pubmed 11371565

 

prodomImg

pubmed

13

202

S=159 I=27 E=1.36745e-10

Enoyl reductase

Pubmed 12172803,12242508

 

prodomImg

pubmed

8

202

S=158 I=26 E=1.71538e-10

DTDP-glucose 4,6-dehydratase

Pubmed 17074846

 

prodomImg

sp

1

337

S=485 I=33 E=2.64754e-50

Zinc-type alcohol dehydrogenase-like protein SERP1785 - Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

 

prodomImg

sp

1

337

S=480 I=33 E=9.0519e-50

Zinc-type alcohol dehydrogenase-like protein SE_1777 - Staphylococcus epidermidis (strain ATCC 12228)

 

prodomImg

sp

1

337

S=480 I=34 E=1.03166e-49

Zinc-type alcohol dehydrogenase-like protein MW2112 - Staphylococcus aureus (strain MW2)

 

prodomImg

sp

1

337

S=480 I=34 E=1.03166e-49

Zinc-type alcohol dehydrogenase-like protein SAS2087 - Staphylococcus aureus (strain MSSA476)

 

prodomImg

sp

1

337

S=476 I=34 E=3.04133e-49

Zinc-type alcohol dehydrogenase-like protein SACOL2177 - Staphylococcus aureus (strain COL)

 

prodomImg

trembl

1

340

S=1493 I=85 E=2.1461e-171

Oxidoreductase - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

340

S=1493 I=85 E=2.1461e-171

Oxidoreductase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

340

S=1377 I=78 E=2.39653e-157

Putative oxidoreductase - Xanthomonas campestris pv. campestris (strain B100)

 

prodomImg

Iprscan IPR016040 [G3DSA:3.40.50.720]

108

311

NAD(P)-binding

Iprscan IPR002085 [PTHR11695]

18

337

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan [PTHR11695:SF34]

18

337

-

Iprscan IPR013149 [PF00107]

151

286

Alcohol dehydrogenase, zinc-binding

Iprscan IPR013154 [PF08240]

31

109

Alcohol dehydrogenase GroES-like

Iprscan IPR014182 [TIGR02817]

2

340

Alcohol dehydrogenase, zinc-binding type 1

Iprscan IPR011032 [SSF50129]

1

141

GroES-like

Iprscan IPR016040 [SSF51735]

122

309

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one SW9UFveT)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits