Xanthomonas axonopodis pv. citri str. 306

  1. XAC1006mdhNP_641353.1malate dehydrogenase

mdh XAC1006
XAC1005
XAC1005
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC1007
XAC1007
ID mdh
AC NP_641353.1
LT XAC1006
SY
OR NC_003919 from 1160899 to 1161885 on strand +
OS Xanthomonas axonopodis pv. citri str. 306
DE malate dehydrogenase
IP Lactate/malate dehydrogenase
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Biological Process: cellular carbohydrate metabolic process (GO:0044262)
Biological Process: malate metabolic process (GO:0006108)
Biological Process: glycolysis (GO:0006096)
Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: binding (GO:0005488)
Molecular Function: malate dehydrogenase activity (GO:0016615)
NAD or NADP as acceptor (GO:0016616)
PM
AN
SQ 328 aa
 
........10........20........30........40........50
| | | | |
MKAPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLELPIEKAQA
ALKGVMMELEDCAFPLLAGMVGTDDAEVAFKDVDVALLVGSRPRGPGMER
KDLLLANAEIFTAQGAALNKVAKRDVKVLVVGNPANTNAYIAMKSAPDLD
PKNFTAMLRLDHNRALSQLSAKLGKPVAGIEKLAVWGNHSPTMYPDYRFA
TADGASIGDAINDQEWNASTFIPTVGKRGAAIIEARGLSSAASAANAAID
HIRDWVLGTSGKWVTMGVPSDGSYGIPEGVMFGFPVTTENGKYTIVKDLP
IDDFSQKYIDKTLAELEEERSGVAHLLG
Hamap MDH_MF_01517 raw_score=11179 norm_score=55.559

Malate dehydrogenase [mdh].

pubmed

1

327

S=1336 I=77 E=2.67387e-153

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 17344419

 

prodomImg

pubmed

2

328

S=1293 I=74 E=4.53215e-148

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 10206992

 

prodomImg

pubmed

6

327

S=1282 I=77 E=1.16114e-146

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 9190829

 

prodomImg

pubmed

2

328

S=1268 I=74 E=5.67108e-145

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 12113928,16133321

 

prodomImg

pubmed

2

327

S=1214 I=70 E=1.79926e-138

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 8900056

 

prodomImg

pubmed

1

326

S=1027 I=62 E=9.17836e-116

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 3771528,2034208

 

prodomImg

pubmed

1

326

S=930 I=57 E=4.36864e-104

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 17194220

 

prodomImg

pubmed

2

326

S=929 I=58 E=5.87608e-104

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 17369815

 

prodomImg

pubmed

1

320

S=854 I=53 E=7.44468e-95

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 12612830

 

prodomImg

pubmed

1

328

S=843 I=50 E=1.84196e-93

Malate dehydrogenase, cytoplasmic EC=1.1.1.37 ; Acetylation NAD Oxidoreductase Phosphoprotein Tricarboxylic acid cycle

Pubmed 8682322,3312200

 

prodomImg

sp

1

328

S=1649 I=96 E=0

Malate dehydrogenase - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

sp

1

328

S=1580 I=91 E=0

Malate dehydrogenase - Xanthomonas campestris pv. campestris

 

prodomImg

sp

1

328

S=1580 I=91 E=0

Malate dehydrogenase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

sp

1

328

S=1571 I=91 E=0

Malate dehydrogenase - Xanthomonas oryzae pv. oryzae

 

prodomImg

sp

1

328

S=1571 I=91 E=0

Malate dehydrogenase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

328

S=1576 I=91 E=0

Malate dehydrogenase - Xanthomonas campestris pv. campestris (strain B100)

 

prodomImg

trembl

1

328

S=1567 I=90 E=2.55042e-180

Malate dehydrogenase - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

trembl

1

328

S=1566 I=90 E=2.64094e-180

Malate dehydrogenase - Stenotrophomonas maltophilia R551-3

 

prodomImg

Iprscan [PD003052]

261

320

-

Iprscan IPR016040 [G3DSA:3.40.50.720]

1

156

NAD(P)-binding

Iprscan IPR015955 [G3DSA:3.90.110.10]

157

326

Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal

Iprscan IPR001557 [PIRSF000102]

4

322

L-lactate/malate dehydrogenase

Iprscan IPR010945 [PTHR23382]

99

327

Malate dehydrogenase, NAD or NADP

Iprscan IPR001236 [PF00056]

5

156

Lactate/malate dehydrogenase

Iprscan IPR001236 [PF02866]

159

327

Lactate/malate dehydrogenase

Iprscan IPR010945 [TIGR01759]

2

323

Malate dehydrogenase, NAD or NADP

Iprscan [SignalP-NN(euk)]

1

27

-

Iprscan IPR016040 [SSF51735]

2

157

NAD(P)-binding

Iprscan IPR015955 [SSF56327]

158

328

Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one XKifwLCQ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits