Xanthomonas axonopodis pv. citri str. 306

  1. XAC0906ahpFNP_641258.1alkyl hydroperoxide reductase subunit F

ahpF XAC0906
XAC0905
XAC0905
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC0907
XAC0907
ID ahpF
AC NP_641258.1
LT XAC0906
SY
OR NC_003919 from 1066931 to 1068523 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE alkyl hydroperoxide reductase subunit F
IP Adrenodoxin reductase; Aromatic-ring hydroxylase; Alkyl hydroperoxide reductase, subunit F; Thioredoxin-like fold
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Biological Process: cell redox homeostasis (GO:0045454)
Molecular Function: NAD binding (GO:0051287)
Molecular Function: electron carrier activity (GO:0009055)
Molecular Function: FAD binding (GO:0050660)
Molecular Function: protein disulfide oxidoreductase activity (GO:0015035)
Molecular Function: oxidoreductase activity (GO:0016491)
acting on NADH or NADPH (GO:0016651)
PM
AN
SQ 530 aa
 
........10........20........30........40........50
| | | | |
MLDANLKTQLTAYLERVTRPIQINASIDDSAGSREMLDLLEELVLLSDKI
SLDIHRDDNQRKPSFALTTPGQDISLRFAGLPMGHEFTSLVLALLQVGGH
PSKAAAELIEQVQHLDGDYQFETYFSLSCQNCPDVVQALNLAAVLNPRIK
HVAIDGAWFQEEVEARQIMSVPTVYLNGELFDQGRMTLEQIVAKLDTNAA
KRDAAKIAAKEAFDVLVVGGGPAGSAAAVYAARKGIRTGVAAERFGGQVL
DTMSIENFISVPETEGPKMAAALEQHVRQYDVDIMNLQRAEQLIPAGADG
LIEIKLANGASLKSKTVILSTGARWRQMNVPGEDQYKNKGVAYCPHCDGP
LFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLVEFDDKLRADEVLQRKLR
SLHNVRIITSAQTTEVLGDGQKVTGLVYKDRTGGDIQHIELEGVFVQIGL
LPNTEFLRGTVALSPRGEVIVDDRGQTDVPGVFAAGDATTVPYKQIVIAM
GEGSKAALSAFDHLIRTSAPATADSVAQAA
xansp

NP_642331.1 lcl|trxB-XAC2005

246

510

S=329 I=32 E=3.90939e-33

thioredoxin reductase

xansp

NP_641518.2 lcl|trxB-XAC1182

245

487

S=198 I=29 E=3.69295e-17

thioredoxin reductase

xansp

NP_643966.1 lcl|lpdA-XAC3659

355

492

S=108 I=30 E=2.32534e-06

dihydrolipoamide dehydrogenase

xansp

NP_643059.1 lcl|XAC2750-XAC2750

307

501

S=106 I=30 E=4.55037e-06

reductase

xansp

NP_641866.1 lcl|ldp-XAC1533

267

492

S=99 I=29 E=2.91455e-05

dihydrolipoamide dehydrogenase

pubmed

1

530

S=2524 I=91 E=0

Alkyl hydroperoxide reductase subunit F EC=1.6.4.- ; FAD Flavoprotein NAD NADP Oxidoreductase Redox-active center

Pubmed 9190810

 

prodomImg

pubmed

1

521

S=1940 I=70 E=0

Alkyl hydroperoxide reductase subunit F EC=1.6.4.- ; FAD Flavoprotein NAD NADP Oxidoreductase Redox-active center

Pubmed 9827328

 

prodomImg

pubmed

1

517

S=1652 I=60 E=0

Alkyl hydroperoxide reductase subunit F EC=1.6.4.- ; FAD Flavoprotein NAD NADP Oxidoreductase Redox-active center

Pubmed 2191951

 

prodomImg

pubmed

1

517

S=1617 I=61 E=0

Strongly similar to alkyl hydroperoxide reductase subunit F ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 16563686

 

prodomImg

pubmed

1

517

S=1528 I=57 E=3.19895e-176

NADH dehydrogenase EC=1.6.99.3 ; Cell membrane Electron transport FAD Flavoprotein Oxidoreductase Redox-active center Ubiquinone

Pubmed 8125345

 

prodomImg

pubmed

1

523

S=1491 I=55 E=7.89502e-172

NADH dehydrogenase EC=1.6.99.3 ; Cell membrane Electron transport FAD Flavoprotein Oxidoreductase Redox-active center Ubiquinone

Pubmed 1917890,2760020

 

prodomImg

pubmed

1

516

S=1479 I=56 E=2.79276e-170

NADH-peroxiredoxin reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 10862622

 

prodomImg

pubmed

1

517

S=1298 I=50 E=2.44811e-148

NADH oxidase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 10960086,8253683

 

prodomImg

pubmed

1

517

S=1256 I=50 E=2.50251e-143

Alkyl hydroperoxide reductase subunit F EC=1.6.4.- ; FAD Flavoprotein NAD NADP Oxidoreductase Redox-active center

Pubmed 15590099

 

prodomImg

pubmed

2

517

S=1236 I=47 E=8.10642e-141

NADH oxidase/alkyl hydroperoxidase reductase (NADH oxidase/alkyl hydroperoxidase reductase peroxide-forming) ; FAD Flavoprotein Oxidoreductase

Pubmed 7765479,10656297

 

prodomImg

sp

1

530

S=2524 I=91 E=0

Alkyl hydroperoxide reductase subunit F - Xanthomonas campestris pv. phaseoli

Pubmed 9190810,

 

prodomImg

sp

1

521

S=1940 I=70 E=0

Alkyl hydroperoxide reductase subunit F - Pseudomonas putida

Pubmed 9827328,

 

prodomImg

sp

1

521

S=1940 I=70 E=0

Alkyl hydroperoxide reductase subunit F - Pseudomonas putida (strain KT2440)

 

prodomImg

sp

1

520

S=1907 I=70 E=0

Alkyl hydroperoxide reductase subunit F - Pseudomonas aeruginosa

 

prodomImg

sp

1

517

S=1678 I=60 E=0

Alkyl hydroperoxide reductase subunit F - Escherichia coli (strain K12)

Pubmed 1592833,

 

prodomImg

trembl

1

530

S=2529 I=91 E=0

Alkyl hydroperoxide reductase subunit F - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

530

S=2472 I=89 E=0

Alkyl hydroperoxide reductase subunit F - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

530

S=2472 I=89 E=0

Alkyl hydroperoxide reductase subunit F - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Iprscan [PD000139]

321

393

-

Iprscan IPR013027 [PR00368]

214

236

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

317

326

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

356

381

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

442

456

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

482

489

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR000759 [PR00419]

214

236

Adrenodoxin reductase

Iprscan IPR000759 [PR00419]

357

371

Adrenodoxin reductase

Iprscan IPR003042 [PR00420]

214

236

Aromatic-ring hydroxylase

Iprscan IPR003042 [PR00420]

493

511

Aromatic-ring hydroxylase

Iprscan IPR000103 [PR00469]

214

236

Pyridine nucleotide-disulphide oxidoreductase, class-II

Iprscan IPR000103 [PR00469]

246

261

Pyridine nucleotide-disulphide oxidoreductase, class-II

Iprscan IPR000103 [PR00469]

266

276

Pyridine nucleotide-disulphide oxidoreductase, class-II

Iprscan IPR000103 [PR00469]

315

323

Pyridine nucleotide-disulphide oxidoreductase, class-II

Iprscan IPR000103 [PR00469]

337

349

Pyridine nucleotide-disulphide oxidoreductase, class-II

Iprscan IPR000103 [PR00469]

352

376

Pyridine nucleotide-disulphide oxidoreductase, class-II

Iprscan IPR000103 [PR00469]

404

420

Pyridine nucleotide-disulphide oxidoreductase, class-II

Iprscan IPR000103 [PR00469]

443

464

Pyridine nucleotide-disulphide oxidoreductase, class-II

Iprscan IPR000103 [PR00469]

477

495

Pyridine nucleotide-disulphide oxidoreductase, class-II

Iprscan IPR012335 [G3DSA:3.40.30.10]

103

197

Thioredoxin fold

Iprscan IPR012335 [G3DSA:3.40.30.10]

1

94

Thioredoxin fold

Iprscan [G3DSA:3.50.50.60]

208

521

-

Iprscan IPR012081 [PIRSF000238]

1

520

Alkyl hydroperoxide reductase, subunit F

Iprscan [PTHR22912]

216

492

-

Iprscan IPR001327 [PF00070]

214

322

Pyridine nucleotide-disulphide oxidoreductase, NAD-binding region

Iprscan IPR001327 [PF00070]

356

449

Pyridine nucleotide-disulphide oxidoreductase, NAD-binding region

Iprscan IPR013027 [PF07992]

214

493

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR012081 [TIGR03140]

1

517

Alkyl hydroperoxide reductase, subunit F

Iprscan IPR008255 [PS00573]

344

364

Pyridine nucleotide-disulphide oxidoreductase, class-II, active site

Iprscan IPR002109 [PS51354]

109

206

Glutaredoxin

Iprscan [SSF51905]

186

514

-

Iprscan IPR012336 [SSF52833]

103

197

Thioredoxin-like fold

Iprscan IPR012336 [SSF52833]

1

102

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 4UJFGcgT)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits