Xanthomonas axonopodis pv. citri str. 306

  1. XAC0882badHNP_641234.1aldehyde dehydrogenase

badH XAC0882
XAC0881
XAC0881
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC0883
XAC0883
ID badH
AC NP_641234.1
LT XAC0882
SY
OR NC_003919 from 1043909 to 1045378 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE aldehyde dehydrogenase
IP Aldehyde/histidinol dehydrogenase
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: oxidoreductase activity (GO:0016491)
PM
AN
SQ 489 aa
 
........10........20........30........40........50
| | | | |
MEALSETLRGIAARGPLGLFIDGQWRASTGDRTVDVIAPHTEERLLRYTE
PSPSDTEAAIAAARSAFDNGPWPQLSPQERSVVLKRVADHLRARMPELAE
AWTGQVGATLGFSKRASQQAPDLFDYYADLIATHAFVQPRVRPSGGRVHV
VQEPVGVVAAITPWNAPLVLLCYKVAAALAAGCTVVAKPSPETPIDAYIL
AECISAAGVPDGVFNLLPAGREVGEQLIRHPHVDKISFTGSTQAGRSIGI
ACAERLARVGLELGGKSAAIVLEDADLAKMLPTLVPYSMPIAGQVCFSLT
RVLVPTQRREEILQAYCTALSAVKLGDPFAADTGMGPLALGRQLERVQSY
IAKGKAEGARLVMGGSRPAHLSRGFFVEPTVFAEVMPDMAIAREEIFGPV
VSFIDYHDEADLIAKANASDYGLHGTIYSEDAERAYRIARRVRSGSHAIN
GMWVDISMPFGGFKHSGIGREGGIEGLHAFLETRTLYLS
xansp

NP_641072.1 lcl|betB-XAC0719

19

488

S=710 I=37 E=2.87184e-79

betaine aldehyde dehydrogenase

xansp

NP_640485.2 lcl|aldA-XAC0129

20

489

S=572 I=35 E=1.56499e-62

chloroacetaldehyde dehydrogenase

xansp

NP_642784.1 lcl|gabD-XAC2469

72

489

S=534 I=30 E=6.40436e-58

succinate-semialdehyde dehydrogenase

xansp

NP_640710.1 lcl|xylC-XAC0354

72

473

S=455 I=31 E=2.19228e-48

benzaldehyde dehydrogenase II

xansp

NP_641647.1 lcl|mmsA-XAC1312

17

486

S=386 I=27 E=4.26142e-40

methylmalonate-semialdehyde dehydrogenase

xansp

NP_642135.1 lcl|XAC1808-XAC1808

22

485

S=383 I=27 E=1.10226e-39

aldehyde dehydrogenase

xansp

NP_644196.1 lcl|putA-XAC3890

53

485

S=340 I=27 E=1.77308e-34

bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase

xansp

NP_644537.1 lcl|alkH-XAC4238

72

486

S=305 I=31 E=3.42809e-30

aldehyde dehydrogenase

pubmed

19

488

S=874 I=43 E=4.41558e-97

Hypothetical aldehyde dehydrogenase ; Plasmid

Pubmed 9025284,10217489

 

prodomImg

pubmed

19

486

S=828 I=44 E=1.74358e-91

6-oxolauric acid dehydrogenase

Pubmed 11591693

 

prodomImg

pubmed

20

486

S=779 I=39 E=1.61798e-85

P-cumic aldehyde dehydrogenase ; Oxidoreductase

Pubmed 8631713,9150211

 

prodomImg

pubmed

19

486

S=779 I=38 E=1.71981e-85

Predicted NAD-dependent aldehyde dehydrogenase

Pubmed 16008504

 

prodomImg

pubmed

19

489

S=763 I=38 E=1.19048e-83

Glycine betaine aldehyde dehydrogenase ; Oxidoreductase

Pubmed 15168170

 

prodomImg

pubmed

20

488

S=762 I=37 E=1.65809e-83

Betaine aldehyde dehydrogenase 1 EC=1.2.1.8 ; NAD Oxidoreductase

Pubmed 9141699

 

prodomImg

pubmed

20

486

S=759 I=37 E=4.51914e-83

Putative aldehyde dehydrogenase SA1924 EC=1.2.1.3 ; NAD Oxidoreductase

Pubmed 15590099

 

prodomImg

pubmed

20

486

S=757 I=39 E=7.96488e-83

NAD-dependent aldehyde dehydrogenase

Pubmed 17894863

 

prodomImg

pubmed

9

489

S=755 I=36 E=1.09971e-82

Aldehyde dehydrogenase 5, mitochondrial EC=1.2.1.3 EC=1.2.1.4 ; Mitochondrion NAD NADP Oxidoreductase Transit peptide

Pubmed 17652520

 

prodomImg

pubmed

9

489

S=754 I=36 E=1.53168e-82

Aldehyde dehydrogenase 5, mitochondrial EC=1.2.1.3 EC=1.2.1.4 ; Mitochondrion NAD NADP Oxidoreductase Transit peptide

Pubmed 9059631

 

prodomImg

sp

20

486

S=776 I=37 E=2.30719e-85

Putative aldehyde dehydrogenase SH0913 - Staphylococcus haemolyticus (strain JCSC1435)

 

prodomImg

sp

20

486

S=770 I=38 E=1.2742e-84

Putative aldehyde dehydrogenase SSP0762 - Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

 

prodomImg

sp

20

486

S=766 I=37 E=3.88965e-84

Putative aldehyde dehydrogenase SAB2006c - Staphylococcus aureus (strain bovine RF122)

 

prodomImg

sp

20

488

S=764 I=38 E=6.39354e-84

Betaine aldehyde dehydrogenase - Rhizobium etli (strain CFN 42 / ATCC 51251)

 

prodomImg

sp

20

488

S=763 I=37 E=8.98287e-84

Betaine aldehyde dehydrogenase - Sinorhizobium medicae (strain WSM419) (Ensifer medicae)

 

prodomImg

trembl

1

489

S=2282 I=92 E=0

Putative aldehyde dehydrogenase - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

489

S=2173 I=89 E=0

Aldehyde dehydrogenase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

489

S=2173 I=89 E=0

Aldehyde dehydrogenase - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Iprscan IPR016162 [G3DSA:3.40.605.10]

16

304

Aldehyde dehydrogenase, N-terminal

Iprscan IPR015590 [PTHR11699]

61

487

Aldehyde dehydrogenase

Iprscan [PTHR11699:SF35]

61

487

-

Iprscan IPR015590 [PF00171]

25

486

Aldehyde dehydrogenase

Iprscan IPR016160 [PS00687]

261

268

Aldehyde dehydrogenase, conserved site

Iprscan IPR016161 [SSF53720]

16

489

Aldehyde/histidinol dehydrogenase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one YvVzY2iM)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits