Xanthomonas axonopodis pv. citri str. 306

  1. XAC0794NP_641146.1quinone reductase

XAC0794
XAC0793
XAC0793
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC0795
XAC0795
ID
AC NP_641146.1
LT XAC0794
SY
OR NC_003919 from 941866 to 942843 on strand +
OS Xanthomonas axonopodis pv. citri str. 306
DE quinone reductase
IP Alcohol dehydrogenase superfamily, zinc-containing; GroES-like; NAD(P)-binding
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: binding (GO:0005488)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: zinc ion binding (GO:0008270)
PM
AN
SQ 325 aa
 
........10........20........30........40........50
| | | | |
MSDTTMTAIAIRDGKGDADALYATEQPRPRPAPGQVLIRVHAAGINRPDL
LQRAGHYPPPPGAPETLGLEIAGEIVEPAGRWKVGDRVCALLGGGGYAQY
AAVDARHVLPIPAGMDLVHAAALPETIFTAYANLFEHGRLAAGQWLLLHG
ATSGIGVTAIQMAKAAGAHVLATARSAVKAAQARELGADVAIDSTTASFV
EVAKAHGGVDVALDMVGAAVFADTLEALNPHGRIVYIASQAGATIEVPIP
VLMRKQAVITGSTLRPRSADEKARLAAEVERVVWPWIEQGKLRVLLDKRF
PLREAAAAHRYLEQGSHLGKVVLEM
xansp

NP_641358.1 lcl|XAC1011-XAC1011

17

323

S=184 I=30 E=1.01767e-15

oxidoreductase

xansp

NP_643205.1 lcl|XAC2896-XAC2896

104

325

S=181 I=30 E=2.00888e-15

alcohol dehydrogenase

xansp

NP_640557.1 lcl|adh-XAC0201

105

325

S=165 I=30 E=2.00553e-13

alcohol dehydrogenase

xansp

NP_644568.1 lcl|XAC4269-XAC4269

2

279

S=160 I=24 E=7.88335e-13

nuclear receptor binding factor related protein

xansp

NP_640643.1 lcl|XAC0287-XAC0287

128

234

S=146 I=37 E=3.98693e-11

quinone oxidoreductase

xansp

NP_644643.1 lcl|XAC4349-XAC4349

17

324

S=95 I=29 E=5.4297e-05

alginate lyase

pubmed

13

325

S=458 I=35 E=6.6417e-47

Putative quinone oxidoreductase EC=1.-.-.- ; Acetylation Alternative splicing Polymorphism

Pubmed 9305847,15067011

 

prodomImg

pubmed

81

325

S=385 I=34 E=4.49168e-38

NADH:quinone reductase and related Zn-dependent oxidoreductases

Pubmed 15608629

 

prodomImg

pubmed

3

323

S=336 I=32 E=3.88731e-32

Zeta-crystallin

Pubmed 11371565

 

prodomImg

pubmed

25

323

S=324 I=34 E=1.31643e-30

Putative NADPH:quinone oxidoreductase GrhO7

Pubmed 12323376

 

prodomImg

pubmed

13

325

S=316 I=35 E=1.10485e-29

EpoD ; Phosphopantetheine Transferase

Pubmed 10649995,10831849

 

prodomImg

pubmed

15

322

S=182 I=33 E=2.24792e-13

EpoD ; Phosphopantetheine Transferase

Pubmed 10649995,10831849

 

prodomImg

pubmed

29

325

S=315 I=31 E=1.52547e-29

Quinone oxidoreductase EC=1.6.5.5 ; Cytoplasm Eye lens protein NADP

Pubmed 2777081,1420281

 

prodomImg

pubmed

13

325

S=314 I=35 E=1.84803e-29

Polyketide synthase ; Phosphopantetheine Transferase

Pubmed 10662695

 

prodomImg

pubmed

15

322

S=176 I=32 E=9.64112e-13

Polyketide synthase ; Phosphopantetheine Transferase

Pubmed 10662695

 

prodomImg

pubmed

29

323

S=307 I=31 E=1.42151e-28

Quinone oxidoreductase EC=1.6.5.5 ; Cytoplasm NADP

Pubmed 8170370

 

prodomImg

sp

13

325

S=458 I=35 E=4.18429e-47

Putative quinone oxidoreductase - Homo sapiens (Human)

Pubmed 9305847,15067011,17224074,

 

prodomImg

sp

29

323

S=317 I=30 E=5.84678e-30

Quinone oxidoreductase - Rattus norvegicus (Rat)

 

prodomImg

sp

29

325

S=315 I=31 E=9.61053e-30

Quinone oxidoreductase - Cavia porcellus (Guinea pig)

Pubmed 2777081,1420281,1370456,

 

prodomImg

sp

29

323

S=307 I=31 E=8.95555e-29

Quinone oxidoreductase - Mus musculus (Mouse)

Pubmed 8170370,8645260,

 

prodomImg

sp

29

323

S=303 I=30 E=2.48378e-28

Quinone oxidoreductase - Homo sapiens (Human)

Pubmed 8466529,8088825,

 

prodomImg

trembl

1

325

S=1548 I=94 E=5.04512e-178

Putative quinone oxidoreductase - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

325

S=1495 I=90 E=1.0261e-171

Quinone reductase - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

325

S=1495 I=90 E=1.0261e-171

Quinone reductase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Iprscan [PR01415]

156

168

-

Iprscan [PR01415]

231

243

-

Iprscan IPR016040 [G3DSA:3.40.50.720]

105

300

NAD(P)-binding

Iprscan IPR002085 [PTHR11695]

20

325

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan IPR014189 [PTHR11695:SF28]

20

325

Quinone oxidoreductase putative, PIG3

Iprscan IPR013149 [PF00107]

142

281

Alcohol dehydrogenase, zinc-binding

Iprscan IPR013154 [PF08240]

33

111

Alcohol dehydrogenase GroES-like

Iprscan IPR014189 [TIGR02824]

6

325

Quinone oxidoreductase putative, PIG3

Iprscan IPR011032 [SSF50129]

6

146

GroES-like

Iprscan IPR016040 [SSF51735]

119

294

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Y6wqgIhl)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits