Xanthomonas axonopodis pv. citri str. 306

  1. XAC0734NP_641087.1alcohol dehydrogenase C

XAC0734
XAC0733
XAC0733
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC0735
XAC0735
ID
AC NP_641087.1
LT XAC0734
SY
OR NC_003919 from 874139 to 875248 on strand +
OS Xanthomonas axonopodis pv. citri str. 306
DE alcohol dehydrogenase C
IP Alcohol dehydrogenase superfamily, zinc-containing; NAD(P)-binding
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: binding (GO:0005488)
PM
AN
SQ 369 aa
 
........10........20........30........40........50
| | | | |
MKSRAAVAFGPGKPLEIVEIDVAPPKAGEVLVRITHTGVCHTDAFTLSGD
DPEGIFPSVLGHEGGGIVEQVGEGVTSVKIGDHVIPLYTAECRKCKFCLS
GKTNLCQAVRATQGKGLMPDGTTRFSYNGEPIYHYMGCSTFSEYTVVPEI
SLAVVNPEAPLEKVCLLGCGVTTGIGAVHNTAKVKPGESVAVFGLGGIGL
AVIQGAVQAKAGRILAIDTNPGKFDLARSMGATDCINPKDYDKPIQEVIV
ELTDGGVDFSFECIGNVNVMRSALECCHKGWGESVIIGVAGAGQEISTRP
FQLVTGRVWRGSAFGGVKGRTQLPGMVEQSMKGAIDLDPFITHTMPLEEI
NEAFHLMHEGKSIRTVIHF
xansp

NP_641005.1 lcl|adhC-XAC0652

1

369

S=1233 I=61 E=9.13496e-143

alcohol dehydrogenase class III

xansp

NP_644054.1 lcl|ybdR-XAC3747

29

265

S=175 I=29 E=1.44679e-14

Zn-dependent alcohol dehydrogenase

xansp

NP_641369.1 lcl|tdh-XAC1022

4

369

S=170 I=23 E=5.16698e-14

L-threonine 3-dehydrogenase

xansp

NP_643205.1 lcl|XAC2896-XAC2896

162

360

S=134 I=29 E=1.25317e-09

alcohol dehydrogenase

xansp

NP_643135.1 lcl|XAC2826-XAC2826

16

266

S=131 I=25 E=2.51727e-09

alcohol dehydrogenase

xansp

NP_640387.1 lcl|yahK-XAC0031

13

357

S=119 I=26 E=8.01996e-08

alcohol dehydrogenase

xansp

NP_642354.1 lcl|fdh-XAC2028

29

265

S=107 I=23 E=2.28134e-06

glutathione-dependent formaldehyde dehydrogenase

pubmed

1

369

S=1580 I=80 E=0

Formaldehyde dehydrogenase (Glutathione) EC=1.2.1.1 ; Metal-binding Oxidoreductase Zinc

Pubmed 8891129

 

prodomImg

pubmed

1

369

S=1572 I=79 E=0

Glutathione-dependent formaldehyde dehydrogenase ; Metal-binding Oxidoreductase Zinc

Pubmed 11577159

 

prodomImg

pubmed

1

369

S=1556 I=78 E=6.75377e-180

Putative alcohol dehydrogenase class III ; Metal-binding Oxidoreductase Plasmid Zinc

Pubmed 18070959

 

prodomImg

pubmed

1

369

S=1556 I=78 E=7.1788e-180

Putative alcohol dehydrogenase class III ; Plasmid

Pubmed 18070959

 

prodomImg

pubmed

1

369

S=1535 I=77 E=2.51526e-177

S-(hydroxymethyl)glutathione dehydrogenase EC=1.1.1.284 EC=1.1.1.- EC=1.1.1.1 ; Cytoplasm Metal-binding NAD Oxidoreductase Plasmid Zinc

Pubmed 8052160

 

prodomImg

pubmed

1

369

S=1451 I=74 E=3.66069e-167

Putative formaldehyde dehydrogenase (Glutathione-dependent) ; Metal-binding Oxidoreductase Zinc

Pubmed 9098058,10591845

 

prodomImg

pubmed

22

369

S=1401 I=74 E=5.07311e-161

HI0185-like protein ; Metal-binding Oxidoreductase Zinc

Pubmed 16714566

 

prodomImg

pubmed

1

369

S=1251 I=63 E=6.21453e-143

Alcohol dehydrogenase class-3 EC=1.1.1.1 EC=1.1.1.284 EC=1.1.1.- ; Cytoplasm Metal-binding NAD Oxidoreductase Zinc

Pubmed 8863743

 

prodomImg

pubmed

1

369

S=1243 I=62 E=7.01547e-142

Class III alcohol dehydrogenase ; Metal-binding Oxidoreductase Zinc

Pubmed 15763521

 

prodomImg

pubmed

1

369

S=1241 I=62 E=9.85667e-142

Alcohol dehydrogenase class-3 chain L EC=1.1.1.1 EC=1.1.1.284 EC=1.1.1.- ; Acetylation Cytoplasm Metal-binding NAD Oxidoreductase Zinc

Pubmed 8931553,7607314

 

prodomImg

sp

1

369

S=1566 I=79 E=0

S-(hydroxymethyl)glutathione dehydrogenase - Shigella sonnei (strain Ss046)

 

prodomImg

sp

1

369

S=1566 I=79 E=0

S-(hydroxymethyl)glutathione dehydrogenase - Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

 

prodomImg

sp

1

369

S=1566 I=79 E=0

S-(hydroxymethyl)glutathione dehydrogenase - Escherichia coli O9:H4 (strain HS)

 

prodomImg

sp

1

369

S=1566 I=79 E=0

S-(hydroxymethyl)glutathione dehydrogenase - Escherichia coli O157:H7

 

prodomImg

sp

1

369

S=1566 I=79 E=0

S-(hydroxymethyl)glutathione dehydrogenase - Escherichia coli O139:H28 (strain E24377A / ETEC)

 

prodomImg

trembl

1

369

S=1846 I=95 E=0

Putative alcohol dehydrogenase class III - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

369

S=1843 I=95 E=0

Alcohol dehydrogenase C - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

369

S=1843 I=95 E=0

S-(Hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Iprscan [G3DSA:3.90.180.10]

1

369

-

Iprscan IPR002085 [PTHR11695]

4

220

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan [PTHR11695:SF4]

4

220

-

Iprscan IPR013149 [PF00107]

186

328

Alcohol dehydrogenase, zinc-binding

Iprscan IPR013154 [PF08240]

27

155

Alcohol dehydrogenase GroES-like

Iprscan IPR014183 [TIGR02818]

2

369

Alcohol dehydrogenase class III/S-(hydroxymethyl)glutathione dehydrogenase

Iprscan IPR002328 [PS00059]

61

75

Alcohol dehydrogenase, zinc-containing, conserved site

Iprscan IPR011032 [SSF50129]

1

190

GroES-like

Iprscan IPR011032 [SSF50129]

317

369

GroES-like

Iprscan IPR016040 [SSF51735]

170

319

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one XKpDJZS1)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits