Xanthomonas axonopodis pv. citri str. 306

  1. XAC0719betBNP_641072.1betaine aldehyde dehydrogenase

betB XAC0719
XAC0718
XAC0718
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC0720
XAC0720
ID betB
AC NP_641072.1
LT XAC0719
SY
OR NC_003919 from 857330 to 858802 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE betaine aldehyde dehydrogenase
IP Betaine aldehyde dehydrogenase; Aldehyde/histidinol dehydrogenase
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Biological Process: betaine biosynthetic process (GO:0006578)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: betaine-aldehyde dehydrogenase activity (GO:0008802)
PM
AN
SQ 490 aa
 
........10........20........30........40........50
| | | | |
MPRFPDQLLYIGGRYVPARGGHTLEVVNPATGEVLANVHNAGVDDLDAAV
DSAKAGQQRWAALTTVERSRILLRAVALLRERNDALAQLETLNTGKPLSE
TRSVDVVTGADVLEYYAGVAQALQGAQVPLREGSFFYTRHEPLGVVGAIG
AWNYPIQIALWKAAPALAAGNAMIFKPSEVTPLTALKLAEIFTEAGLPDG
VFNVLPGDGASVGTALTEHPQIEKISFTGGTATGRKVMASASSSSLKEVT
MELGGKSPLIVCADADLDVAADIAMMANFYSSGQVCTNGTRVFVPRALRH
AFEARLLARVQRIHIGDPLDERTTFGPLASAAHMQRVLEHIEQGKAEGAR
LLCGGERLQDGALVQGYYVAPTIFSDCTDVMTIVREEIFGPVLSLLTYDD
EDEAVTRANATTYGLAAGVVTPDLARAHRLIHRLEAGICWVNTWGESPAP
MPVGGYKQSGVGRENGLATLQAYTRTKSVQIELERYASVF
xansp

NP_640485.2 lcl|aldA-XAC0129

2

481

S=757 I=37 E=5.28017e-85

chloroacetaldehyde dehydrogenase

xansp

NP_641234.1 lcl|badH-XAC0882

9

481

S=626 I=35 E=3.64417e-69

aldehyde dehydrogenase

xansp

NP_640710.1 lcl|xylC-XAC0354

13

484

S=484 I=31 E=7.03062e-52

benzaldehyde dehydrogenase II

xansp

NP_642784.1 lcl|gabD-XAC2469

23

481

S=456 I=29 E=1.44606e-48

succinate-semialdehyde dehydrogenase

xansp

NP_641647.1 lcl|mmsA-XAC1312

5

479

S=425 I=32 E=9.56685e-45

methylmalonate-semialdehyde dehydrogenase

xansp

NP_642135.1 lcl|XAC1808-XAC1808

10

482

S=407 I=28 E=1.41396e-42

aldehyde dehydrogenase

xansp

NP_644196.1 lcl|putA-XAC3890

26

466

S=366 I=28 E=1.22473e-37

bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase

xansp

NP_644537.1 lcl|alkH-XAC4238

140

442

S=284 I=30 E=1.00256e-27

aldehyde dehydrogenase

pubmed

1

490

S=1618 I=62 E=0

Betaine aldehyde dehydrogenase EC=1.2.1.8 ; NAD Oxidoreductase Stress response

Pubmed 1956285,1879697

 

prodomImg

pubmed

7

490

S=1525 I=60 E=6.93997e-176

Betaine aldehyde dehydrogenase EC=1.2.1.8 ; NAD Oxidoreductase

Pubmed 10708384

 

prodomImg

pubmed

5

483

S=1118 I=48 E=1.19476e-126

Betaine aldehyde dehydrogenase 1 EC=1.2.1.8 ; NAD Oxidoreductase

Pubmed 9141699

 

prodomImg

pubmed

10

484

S=1090 I=47 E=3.33428e-123

Betaine aldehyde dehydrogenase 2 EC=1.2.1.8 ; NAD Oxidoreductase Plasmid

Pubmed 11481432

 

prodomImg

pubmed

8

490

S=1075 I=45 E=1.92188e-121

4-trimethylaminobutyraldehyde dehydrogenase EC=1.2.1.47 EC=1.2.1.3 EC=1.2.1.19 ; Acetylation Cytoplasm NAD Oxidoreductase Polymorphism

Pubmed 8786138,10702312

 

prodomImg

pubmed

8

490

S=1072 I=45 E=5.47151e-121

4-trimethylaminobutyraldehyde dehydrogenase EC=1.2.1.47 EC=1.2.1.3 ; Acetylation Cytoplasm NAD Oxidoreductase

Pubmed 10702312

 

prodomImg

pubmed

6

490

S=1068 I=44 E=1.31991e-120

Betaine aldehyde dehydrogenase EC=1.2.1.8 EC=1.2.1.3 ; Cytoplasm NAD Oxidoreductase

Pubmed 9792097

 

prodomImg

pubmed

12

490

S=1053 I=44 E=1.00563e-118

4-trimethylaminobutyraldehyde dehydrogenase EC=1.2.1.47 EC=1.2.1.3 ; Acetylation Cytoplasm NAD Oxidoreductase

Pubmed 10702312

 

prodomImg

pubmed

6

482

S=1049 I=44 E=2.86298e-118

Aldehyde dehydrogenase family 9 member A1 EC=1.2.1.3 ; Cytoplasm NAD Oxidoreductase

Pubmed 17236798

 

prodomImg

pubmed

9

484

S=897 I=38 E=8.1704e-100

4-hydroxymuconic semialdehyde dehydrogenase EC=1.2.1.61 ; Oxidoreductase

Pubmed 11322873,18502868

 

prodomImg

sp

1

490

S=2271 I=89 E=0

Betaine aldehyde dehydrogenase - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

sp

1

490

S=2150 I=86 E=0

Betaine aldehyde dehydrogenase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

sp

1

490

S=2137 I=86 E=0

Betaine aldehyde dehydrogenase - Xanthomonas campestris pv. campestris

 

prodomImg

sp

1

490

S=1740 I=69 E=0

Betaine aldehyde dehydrogenase - Pseudomonas aeruginosa

 

prodomImg

sp

1

490

S=1738 I=68 E=0

Betaine aldehyde dehydrogenase - Pseudomonas aeruginosa (strain UCBPP-PA14)

 

prodomImg

trembl

1

490

S=2150 I=86 E=0

Betaine aldehyde dehydrogenase - Xanthomonas campestris pv. campestris (strain B100)

 

prodomImg

trembl

1

490

S=1652 I=65 E=0

Putative betaine aldehyde dehydrogenase - Stenotrophomonas maltophilia (strain K279a)

 

prodomImg

trembl

1

490

S=1650 I=64 E=0

Betaine aldehyde dehydrogenase - Pseudomonas putida (strain W619)

 

prodomImg

Iprscan IPR016162 [G3DSA:3.40.605.10]

9

294

Aldehyde dehydrogenase, N-terminal

Iprscan IPR015590 [PTHR11699]

51

483

Aldehyde dehydrogenase

Iprscan [PTHR11699:SF47]

51

483

-

Iprscan IPR015590 [PF00171]

15

479

Aldehyde dehydrogenase

Iprscan IPR011264 [TIGR01804]

10

477

Betaine aldehyde dehydrogenase

Iprscan IPR016160 [PS00070]

279

290

Aldehyde dehydrogenase, conserved site

Iprscan IPR016160 [PS00687]

251

258

Aldehyde dehydrogenase, conserved site

Iprscan IPR016161 [SSF53720]

9

482

Aldehyde/histidinol dehydrogenase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Rn57WGL1)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits