Xanthomonas axonopodis pv. citri str. 306

  1. XAC0598pheCNP_640951.2cyclohexadienyl dehydratase

pheC XAC0598
XAC0597
XAC0597
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC0599
XAC0599
ID pheC
AC NP_640951.2
LT XAC0598
SY
OR NC_003919 from 701967 to 702746 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE cyclohexadienyl dehydratase
IP Bacterial extracellular solute-binding protein, family 3
CL
EC
GO Biological Process: transport (GO:0006810)
Cellular Component: outer membrane-bounded periplasmic space (GO:0030288)
Molecular Function: transporter activity (GO:0005215)
PM
AN
SQ 259 aa
 
........10........20........30........40........50
| | | | |
MRYRICLALLLSCGTTHAATPASRLDAVLQSGVLRVCTTGDYRPYSLLRD
DGQFEGSDIDLVQSLAASLDARVRLVRTSWPHLLPDLLADRCDIAVGGIS
VTLQRQRQASFSAVLDVDGKIPLVRCVDQARYRTLEQLNRPEVRLIEPPG
GTNEAFAHRQLPQAALRLFADNTTIFQELLAHRADVMITDASEALYQQAR
LPGLCAIAPEQPLQYSEKAFLLPRDDHAWKAYVDQWLHLTKASGEYRRIV
EGWRQPRTE
pubmed

23

257

S=619 I=51 E=1.51295e-66

Cyclohexadienyl dehydratase EC=4.2.1.51 EC=4.2.1.91 ; Amino-acid biosynthesis Aromatic Lyase Multifunctional enzyme Periplasm Phenylalanine Signa

Pubmed 1733946

 

prodomImg

pubmed

23

132

S=306 I=53 E=1.26378e-28

Cyclohexadienyl dehydratase

Pubmed 17185531

 

prodomImg

pubmed

6

253

S=191 I=24 E=1.13486e-14

FliY (Putative periplasmic binding transport protein)

Pubmed 10411266

 

prodomImg

pubmed

6

253

S=183 I=24 E=9.94908e-14

Cystine-binding periplasmic protein ; Signal Transport

Pubmed 8550423

 

prodomImg

pubmed

6

258

S=176 I=23 E=8.06388e-13

Probable binding protein component of ABC transporter

Pubmed 16581904

 

prodomImg

pubmed

6

253

S=165 I=25 E=1.44503e-11

GlnH-like protein ; Plasmid

Pubmed 12511498

 

prodomImg

pubmed

5

253

S=156 I=26 E=2.19415e-10

Lysine-arginine-ornithine-binding periplasmic protein ; Amino-acid transport Signal

Pubmed 6273842

 

prodomImg

pubmed

34

253

S=144 I=22 E=6.51955e-09

Glutamine high-affinity transporter (High-affinity periplasmic glutamine binding protein)

Pubmed 9009317

 

prodomImg

pubmed

34

253

S=142 I=22 E=1.12919e-08

Glutamine-binding periplasmic protein ; Amino-acid transport Signal

Pubmed 3027504

 

prodomImg

pubmed

6

253

S=140 I=23 E=1.74619e-08

High affinity cystine binding protein

Pubmed 9150229,10094698

 

prodomImg

sp

23

257

S=619 I=51 E=9.54326e-67

Cyclohexadienyl dehydratase precursor [Includes: Prephenate dehydratase - Pseudomonas aeruginosa

Pubmed 1733946,8515238,7604006,

 

prodomImg

sp

6

253

S=183 I=24 E=6.2756e-14

Cystine-binding periplasmic protein precursor - Escherichia coli (strain K12)

Pubmed 8550423,8450713,8774726,

 

prodomImg

sp

6

253

S=183 I=24 E=6.2756e-14

Cystine-binding periplasmic protein precursor - Escherichia coli O6

 

prodomImg

sp

5

253

S=156 I=26 E=1.38401e-10

Lysine-arginine-ornithine-binding periplasmic protein precursor - Salmonella typhimurium

Pubmed 6273842,1748660,8496186,

 

prodomImg

sp

34

253

S=142 I=22 E=7.12261e-09

Glutamine-binding periplasmic protein precursor - Escherichia coli (strain K12)

Pubmed 3027504,8831790,9571045,

 

prodomImg

trembl

1

257

S=1293 I=96 E=2.53865e-147

Putative carboxycyclohexadienyl dehydratase precursor - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

253

S=1049 I=82 E=8.54612e-118

Cyclohexadienyl dehydratase - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

1

253

S=1049 I=82 E=8.54612e-118

Cyclohexadienyl dehydratase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan [G3DSA:3.40.190.10]

29

125

-

Iprscan IPR001638 [PF00497]

34

256

Bacterial extracellular solute-binding protein, family 3

Iprscan IPR001638 [SM00062]

33

257

Bacterial extracellular solute-binding protein, family 3

Iprscan [SignalP-NN(euk)]

1

18

-

Iprscan [SSF53850]

29

253

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 1hMOYeJ8)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits