Xanthomonas axonopodis pv. citri str. 306

  1. XAC0403hrcQNP_640758.1HrcQ protein

hrcQ XAC0403
XAC0402
XAC0402
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC0404
XAC0404
ID hrcQ
AC NP_640758.1
LT XAC0403
SY
OR NC_003919 from 473845 to 474759 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE HrcQ protein
IP Type III secretion system apparatus protein YscQ/HrcQ
CL
EC
GO Biological Process: protein secretion by the type III secretion system (GO:0030254)
PM
AN
SQ 304 aa
 
........10........20........30........40........50
| | | | |
MFGDPRAARQCGFATHRRRISPNDAARLRLQLDTGQMDVRIAARDGLALL
LNEDDHALRVSIAGILLADRLGALAPLGLGAAEVIAFERDAEPDDCHGIG
ITLGDLDAIALTASAPLLATLRTAVAALAAPAPLPVWLAALRVNTRLRIG
ERTASAALLQSLRPGDVLLHCTASAAATSGEVLWGIAGGAVLRAPVRLNL
QQMILEATPTMQHDTFEPEVAQSASNVAELELPVQLEVDQLALSLSTLSG
LQPGQILELSVPVDQADIRLVVYGQTIGIGRLVTVGEHLGVQILSMSEST
HADA
pubmed

1

304

S=1201 I=81 E=5.2756e-137

HrcQ homolog

Pubmed 10478481

 

prodomImg

pubmed

1

304

S=1201 I=81 E=5.2756e-137

HrcQ

Pubmed 12730176

 

prodomImg

pubmed

1

304

S=1177 I=79 E=5.17143e-134

HrcQ

Pubmed 15812033,18326683

 

prodomImg

pubmed

1

304

S=1131 I=76 E=1.79171e-128

HrcQ

Pubmed 16957248

 

prodomImg

pubmed

1

304

S=1123 I=76 E=1.49069e-127

HrcQ

Pubmed 11410350

 

prodomImg

pubmed

37

304

S=964 I=75 E=2.9991e-108

HrcQ

Pubmed 9781876,11844763

 

prodomImg

pubmed

37

107

S=259 I=76 E=8.60246e-23

Pathogenicity protein

Pubmed 1312532

 

prodomImg

pubmed

147

297

S=227 I=37 E=5.64183e-19

SctQ

Pubmed 10403415,11990489

 

prodomImg

pubmed

146

303

S=185 I=35 E=8.53805e-14

HrpQ protein (Hrp conserved protein hrcq)

Pubmed 1479894,1472716

 

prodomImg

pubmed

198

298

S=131 I=30 E=2.92999e-07

BcscQ

Pubmed 11557147

 

prodomImg

sp

161

300

S=125 I=34 E=9.93784e-07

Yop proteins translocation protein Q - Yersinia pseudotuberculosis

Pubmed 8169210,

 

prodomImg

sp

161

300

S=125 I=34 E=9.93784e-07

Yop proteins translocation protein Q - Yersinia pestis

Pubmed 8300512,9746557,9748454,

 

prodomImg

trembl

1

304

S=1201 I=81 E=3.93411e-136

HrcQ homolog - Xanthomonas campestris pv. glycines

Pubmed 10478481,

 

prodomImg

trembl

1

304

S=1201 I=81 E=3.93411e-136

HrcQ - Xanthomonas axonopodis pv. glycines

Pubmed 12730176,

 

prodomImg

trembl

1

304

S=1177 I=79 E=3.85643e-133

HrcQ - Xanthomonas fuscans subsp. fuscans

Pubmed 15812033,18326683,

 

prodomImg

Iprscan [PD001777]

232

299

-

Iprscan IPR001543 [PF01052]

223

300

Surface presentation of antigens (SPOA) protein

Iprscan IPR013385 [TIGR02551]

33

296

Type III secretion system apparatus protein YscQ/HrcQ

Iprscan IPR001543 [SSF101801]

221

301

Surface presentation of antigens (SPOA) protein

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one HqncGrjl)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits