Xanthomonas axonopodis pv. citri str. 306

  1. XAC0307NP_640663.1nucleoside hydrolase

XAC0307
XAC0306
XAC0306
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC0308
XAC0308
ID
AC NP_640663.1
LT XAC0307
SY
OR NC_003919 from 366399 to 367568 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE nucleoside hydrolase
IP Inosine/uridine-preferring nucleoside hydrolase
CL
EC
GO
PM
AN
SQ 389 aa
 
........10........20........30........40........50
| | | | |
MPHSIAGAMPSTFHDKNAMTDPHLPSSRRRVILEDDIDGFTPAQLLLLQS
PDVEVLGISAVSGNIWRDEVLAHTCRLLELAGHPQIPVLPGPVHPLINSE
LATERWEALYGKLVWKGAWTKHWVDGDTVQSAPRYHAHDVVPDLALGNPS
VVRPSDEPAALFMLRMVRQYPGEVSIIATGPLTNLALAQSLDPAFATLAR
ELVYMGGSLNPRQQRNSVSAQQFAREFINSPRREFNIRWDPEAASIVMRA
PWRRITMVPVDPSTATELTAELLARMSAADTTIGHALRRREPGFPMWDEL
ATAVWLRPELARHTETLYVDTNTAFDAGYGDILSWAPGYQPGLGEQAQTV
VHAVDVPALEQLLVDRLTAPQPPAVGSPLPLRPSGPRSP
xansp

NP_641480.1 lcl|XAC1144-XAC1144

159

271

S=133 I=39 E=1.70703e-09

inosine-uridine preferring nucleoside hydrolase

xansp

NP_643697.1 lcl|XAC3390-XAC3390

132

250

S=108 I=38 E=1.9921e-06

inosine-uridine preferring nucleoside hydrolase

pubmed

27

269

S=178 I=30 E=7.3782e-13

Putative inosine-uridine preferring nucleoside hydrolase EC=3.2.2.1 ; Glycosidase

Pubmed 16204499

 

prodomImg

pubmed

128

281

S=159 I=31 E=1.62853e-10

Nucleoside hydrolase

Pubmed 16707707

 

prodomImg

pubmed

29

282

S=140 I=27 E=3.1815e-08

Inosine-uridine preferring nucleoside hydrolase EC=3.2.2.- ; Calcium Glycosidase Metal-binding Nucleotide metabolism

Pubmed 8634237,8634238

 

prodomImg

pubmed

26

368

S=139 I=28 E=3.72211e-08

Ribonucleoside hydrolase 1

Pubmed 16549679

 

prodomImg

pubmed

156

259

S=133 I=36 E=2.28235e-07

Putative purine hydrolase (Salivary purine nucleosidase)

Pubmed 12213246,12459196

 

prodomImg

sp

23

369

S=317 I=27 E=6.67691e-30

Uncharacterized protein C800.11 precursor - Schizosaccharomyces pombe (Fission yeast)

 

prodomImg

sp

45

367

S=165 I=26 E=1.64297e-11

Uncharacterized protein C1683.06c - Schizosaccharomyces pombe (Fission yeast)

 

prodomImg

sp

29

282

S=140 I=27 E=2.00277e-08

Inosine-uridine preferring nucleoside hydrolase - Crithidia fasciculata

Pubmed 8634237,8634238,

 

prodomImg

sp

136

210

S=118 I=33 E=8.50093e-06

Uncharacterized protein in bps2 5'region - Acidianus ambivalens (Desulfurolobus ambivalens)

 

prodomImg

trembl

1

375

S=1861 I=95 E=0

Putative nucleoside hydrolase - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

19

375

S=1708 I=92 E=0

Nucleoside hydrolase - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

19

375

S=1708 I=92 E=0

Nucleoside hydrolase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan [PD007736]

45

247

-

Iprscan IPR001910 [G3DSA:3.90.245.10]

15

370

Inosine/uridine-preferring nucleoside hydrolase

Iprscan IPR001910 [PTHR12304]

153

371

Inosine/uridine-preferring nucleoside hydrolase

Iprscan IPR001910 [PTHR12304]

27

128

Inosine/uridine-preferring nucleoside hydrolase

Iprscan IPR001910 [PTHR12304]

27

371

Inosine/uridine-preferring nucleoside hydrolase

Iprscan IPR001910 [PF01156]

28

358

Inosine/uridine-preferring nucleoside hydrolase

Iprscan [SignalP-NN(euk)]

1

1

-

Iprscan IPR001910 [SSF53590]

28

373

Inosine/uridine-preferring nucleoside hydrolase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 1ZiKmDLk)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits