Xanthomonas axonopodis pv. citri str. 306

  1. XAC0287NP_640643.1quinone oxidoreductase

XAC0287
XAC0286
XAC0286
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC0288
XAC0288
ID
AC NP_640643.1
LT XAC0287
SY
OR NC_003919 from 340916 to 341944 on strand -
OS Xanthomonas axonopodis pv. citri str. 306
DE quinone oxidoreductase
IP Alcohol dehydrogenase superfamily, zinc-containing; NAD(P)-binding
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: binding (GO:0005488)
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: catalytic activity (GO:0003824)
PM
AN
SQ 342 aa
 
........10........20........30........40........50
| | | | |
MTSIINRRIVLASRPHGEPSADNFRIEEVPVAPTGHDQILVRNRFLSLDP
YMRGRMDEGPSYAAPVAIDAVMEGGTVGEVIASNHADYHPGDLLVLPGGW
QAHSLLTPTTPLRKLPKDDSLPPSTALGVYGMPGFTAYAGLHEIGKPQPG
ETLVVAAASGPVGATVAQLARLQGLRVVAIAGGAEKVRYLRDTLHVDVAL
DHRADDFAEQLRAATPNGIDIYFENVGGKVFDAVLPQLNEFARIPVCGVI
ATYNSRGQAHPGPDRLPDFMGQVLRKRLTVRGFIQHDFIRLMPAFLREMG
QWLREDKIQYREHVLHGLDSAPQGLIDVLRGKNFGKAVVALA
xansp

NP_641146.1 lcl|XAC0794-XAC0794

135

244

S=144 I=37 E=6.30438e-11

quinone reductase

xansp

NP_640557.1 lcl|adh-XAC0201

138

341

S=124 I=27 E=1.59983e-08

alcohol dehydrogenase

pubmed

7

342

S=712 I=43 E=1.14194e-77

NADP-dependent oxidoreductase-like protein

Pubmed 17636987

 

prodomImg

pubmed

6

342

S=684 I=39 E=3.02444e-74

YfmJ protein

Pubmed 9272861

 

prodomImg

pubmed

1

342

S=582 I=39 E=6.67807e-62

Probable NADP-dependent oxidoreductase P1 EC=1.3.1.74

Pubmed 7592828

 

prodomImg

pubmed

6

342

S=582 I=39 E=7.03671e-62

Probable NADP-dependent oxidoreductase P2 EC=1.3.1.74

Pubmed 7592828

 

prodomImg

pubmed

4

342

S=568 I=37 E=3.55875e-60

Allyl alcohol dehydrogenase

Pubmed 11117876

 

prodomImg

pubmed

7

340

S=559 I=36 E=3.84603e-59

Prostaglandin reductase 1 EC=1.3.1.- EC=1.3.1.74 EC=1.3.1.48 ; Cytoplasm NADP Oxidoreductase

Pubmed 11733004,15007077

 

prodomImg

pubmed

7

341

S=537 I=36 E=1.94347e-56

Leukotriene B4

Pubmed 10800079

 

prodomImg

pubmed

7

339

S=513 I=35 E=1.67155e-53

Prostaglandin reductase 1 EC=1.3.1.- EC=1.3.1.74 EC=1.3.1.48 ; Cytoplasm NADP Oxidoreductase

Pubmed 8968041

 

prodomImg

pubmed

6

342

S=503 I=34 E=2.58275e-52

Alcohol dehydrogenase-like protein

Pubmed 16150417

 

prodomImg

pubmed

17

339

S=499 I=37 E=7.95318e-52

Prostaglandin reductase 1 EC=1.3.1.- EC=1.3.1.74 EC=1.3.1.48 ; Cytoplasm NADP Oxidoreductase

Pubmed 8576264,9461497

 

prodomImg

sp

6

342

S=981 I=58 E=1.99731e-110

Putative NADP-dependent oxidoreductase yncB - Escherichia coli (strain K12)

 

prodomImg

sp

1

342

S=582 I=39 E=4.24238e-62

Probable NADP-dependent oxidoreductase P1 - Arabidopsis thaliana (Mouse-ear cress)

Pubmed 7592828,

 

prodomImg

sp

6

342

S=582 I=39 E=4.47022e-62

Probable NADP-dependent oxidoreductase P2 - Arabidopsis thaliana (Mouse-ear cress)

Pubmed 7592828,

 

prodomImg

sp

7

340

S=559 I=36 E=2.44327e-59

NADP-dependent leukotriene B4 12-hydroxydehydrogenase - Cavia porcellus (Guinea pig)

 

prodomImg

sp

17

339

S=532 I=36 E=5.8282e-56

NADP-dependent leukotriene B4 12-hydroxydehydrogenase - Bos taurus (Bovine)

 

prodomImg

trembl

1

341

S=1646 I=93 E=0

Zinc-containing alcohol dehydrogenase superfamily protein - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

341

S=1583 I=89 E=0

Quinone oxidoreductase - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

trembl

1

341

S=1581 I=89 E=0

Quinone oxidoreductase - Xanthomonas oryzae pv. oryzae

 

prodomImg

Iprscan [G3DSA:3.90.180.10]

4

156

-

Iprscan IPR002085 [PTHR11695]

23

342

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan [PTHR11695:SF5]

23

342

-

Iprscan IPR013149 [PF00107]

149

301

Alcohol dehydrogenase, zinc-binding

Iprscan IPR011032 [SSF50129]

293

341

GroES-like

Iprscan IPR011032 [SSF50129]

3

151

GroES-like

Iprscan IPR016040 [SSF51735]

122

307

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 12DMSLyi)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits