Xanthomonas axonopodis pv. citri str. 306

  1. XAC0273NP_640629.1cytochrome C5

XAC0273
XAC0272
XAC0272
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC0274
XAC0274
ID
AC NP_640629.1
LT XAC0273
SY
OR NC_003919 from 326288 to 326806 on strand +
OS Xanthomonas axonopodis pv. citri str. 306
DE cytochrome C5
IP Cytochrome c, class IE
CL
EC
GO Molecular Function: heme binding (GO:0020037)
Molecular Function: iron ion binding (GO:0005506)
Molecular Function: electron carrier activity (GO:0009055)
PM
AN
SQ 172 aa
 
........10........20........30........40........50
| | | | |
MRNYDLEFLKKFSMVIGLLVVITLGLIALAAYLQRAIPDEVSPTAAKRVL
QRIAPAGAVYAGATGASAQAAAQAAALAKAASQSAYGGTTDGKTIFNNLC
TACHTTGVGKAPTLDHSHWDARIAQGKDTLYKHAIEGYTGPDGGIMPPKG
GNPALTEEQVRATVDWMLGNLK
pubmed

92

172

S=163 I=41 E=1.47087e-11

Cytochrome c-555 ; Electron transport Heme Iron Metal-binding Photosynthesis

Pubmed 188412,202947

 

prodomImg

pubmed

91

171

S=151 I=38 E=4.14767e-10

Cytochrome c-555 ; Electron transport Heme Iron Metal-binding Photosynthesis

Pubmed 188412

 

prodomImg

pubmed

88

167

S=132 I=33 E=8.68825e-08

Probable cytochrome C

Pubmed 16514165

 

prodomImg

pubmed

91

167

S=123 I=36 E=9.47185e-07

Soluble cytochrome cA

Pubmed 10781566

 

prodomImg

pubmed

91

167

S=123 I=35 E=1.03347e-06

Mono-heme c-type cytochrome ScyA

Pubmed 11955059

 

prodomImg

pubmed

91

167

S=119 I=36 E=3.12742e-06

Cytochrome c (Cytochrome c, class I) ; Signal

Pubmed 17142390

 

prodomImg

sp

92

172

S=176 I=45 E=2.5077e-13

Cytochrome c-555 precursor - Chlorobium tepidum

 

prodomImg

sp

92

172

S=163 I=41 E=9.51149e-12

Cytochrome c-555 - Chlorobium limicola f.sp. thiosulfatophilum

Pubmed 188412,202947,

 

prodomImg

sp

91

171

S=151 I=38 E=2.68213e-10

Cytochrome c-555 - Prosthecochloris aestuarii

Pubmed 188412,

 

prodomImg

trembl

1

172

S=614 I=71 E=2.29506e-65

Putative cytochrome c precursor - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

172

S=604 I=69 E=3.64012e-64

Cytochrome C5 - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

172

S=601 I=69 E=7.44061e-64

Cytochrome C5 - Xanthomonas oryzae pv. oryzae

 

prodomImg

Iprscan IPR002323 [PR00607]

142

154

Cytochrome c, class IE

Iprscan IPR002323 [PR00607]

157

168

Cytochrome c, class IE

Iprscan IPR002323 [PR00607]

99

110

Cytochrome c, class IE

Iprscan IPR009056 [G3DSA:1.10.760.10]

86

170

Cytochrome c, monohaem

Iprscan IPR003088 [PF00034]

89

171

Cytochrome c, class I

Iprscan IPR009056 [PS51007]

87

171

Cytochrome c, monohaem

Iprscan [SignalP-NN(euk)]

1

30

-

Iprscan [tmhmm]

12

34

-

Iprscan IPR009056 [SSF46626]

14

170

Cytochrome c, monohaem

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one BNDKwXDq)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits