Xanthomonas axonopodis pv. citri str. 306

  1. XAC0204glnANP_640560.1glutamine synthetase

glnA XAC0204
XAC0203
XAC0203
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC0205
XAC0205
ID glnA
AC NP_640560.1
LT XAC0204
SY
OR NC_003919 from 250876 to 252285 on strand +
OS Xanthomonas axonopodis pv. citri str. 306
DE glutamine synthetase
IP Glutamine synthetase type I
CL
EC
GO Biological Process: nitrogen fixation (GO:0009399)
Biological Process: nitrogen compound metabolic process (GO:0006807)
Biological Process: glutamine biosynthetic process (GO:0006542)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: glutamate-ammonia ligase activity (GO:0004356)
Molecular Function: catalytic activity (GO:0003824)
PM
AN
SQ 469 aa
 
........10........20........30........40........50
| | | | |
MSVENVEKLIKDNKVEFVDLRFVDMRGVQQHITFPVNIIEPALFEEGKMF
DGSSIAGWKGINESDMVLLPDAGTAYLDPFFADPTIVLTCDILDPATMQS
YERDPRGIAKRAEAYLKSSGTADQAFFGPEPEFFIFDSVRFANDMGHTFF
QVGSEEAAWNTGEKYDGGNSGYRPGVKGGYFPVPPTDSLHDLRAEMIKTL
EQVGIETEVHHHEVATAGQCEIGTKFSSLVQKADELLTMKYIIKNVAYRN
GKTATFMPKPIVGDNGSGMHVHQSLAKGGVNLFTGDGYGGLSQLALWYIG
GIFKHARAINAFANSGTNSYKRLVPGFEAPVMLAYSARNRSASCRIPWVT
NPKARRIEMRFPDPLQSGYLTFTALMMAGLDGIKNQIDPGAPSDKDLYDL
PPEEEKLIPQVCSSLDQALEALDKDREFLKAGGVMSDDFIDGYIALKMQE
VTKFRAATHPLEYQLYYGN
xansp

NP_642793.1 lcl|glnA-XAC2478

62

454

S=308 I=28 E=1.2398e-30

glutamine synthetase

xansp

NP_642795.1 lcl|glnA-XAC2480

60

398

S=201 I=27 E=1.24799e-17

glutamine synthase

pubmed

1

467

S=1795 I=69 E=0

Glutamine synthetase EC=6.3.1.2 ; Cytoplasm Ligase Nucleotide-binding

Pubmed 1969923

 

prodomImg

pubmed

2

467

S=1692 I=66 E=0

Glutamine synthetase EC=6.3.1.2 ; Ligase

Pubmed 11064198

 

prodomImg

pubmed

1

467

S=1687 I=66 E=0

Glutamine synthetase EC=6.3.1.2 ; Cytoplasm Ligase Nucleotide-binding

Pubmed 2574025

 

prodomImg

pubmed

1

467

S=1679 I=64 E=0

Glutamine synthetase EC=6.3.1.2 ; Cytoplasm Ligase Nucleotide-binding

Pubmed 2879772

 

prodomImg

pubmed

1

467

S=1672 I=63 E=0

Glutamine synthetase EC=6.3.1.2 ; Cytoplasm Ligase Nucleotide-binding

Pubmed 2882477,2874141

 

prodomImg

pubmed

1

467

S=1668 I=64 E=0

Glutamine synthetase EC=6.3.1.2 ; Cytoplasm Ligase Nucleotide-binding

Pubmed 8095910

 

prodomImg

pubmed

1

467

S=1661 I=63 E=0

Glutamine synthetase EC=6.3.1.2 ; Ligase

Pubmed 15644904

 

prodomImg

pubmed

8

467

S=1650 I=64 E=0

Glutamine synthetase EC=6.3.1.2 ; Cytoplasm Ligase Nitrogen fixation Nucleotide-binding

Pubmed 1977737

 

prodomImg

pubmed

8

467

S=1622 I=64 E=0

Glutamine synthetase EC=6.3.1.2 ; Ligase

Pubmed 16495669

 

prodomImg

pubmed

1

467

S=1612 I=62 E=0

Glutamine synthetase EC=6.3.1.2 ; Ligase

Pubmed 11040434

 

prodomImg

sp

1

467

S=1795 I=69 E=0

Glutamine synthetase - Methylococcus capsulatus

Pubmed 1969923,

 

prodomImg

sp

1

467

S=1703 I=66 E=0

Glutamine synthetase - Vibrio cholerae

 

prodomImg

sp

1

467

S=1687 I=66 E=0

Glutamine synthetase - Vibrio alginolyticus

Pubmed 2574025,

 

prodomImg

sp

1

467

S=1679 I=64 E=0

Glutamine synthetase - Salmonella typhimurium

Pubmed 2879772,2572586,11329256,

 

prodomImg

sp

1

467

S=1679 I=64 E=0

Glutamine synthetase - Salmonella typhi

 

prodomImg

trembl

1

469

S=2520 I=100 E=0

Glutamine synthetase, type I - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

469

S=2511 I=99 E=0

Glutamine synthetase - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

469

S=2511 I=99 E=0

Glutamine synthetase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Iprscan [PD001057]

110

467

-

Iprscan [G3DSA:3.10.20.70]

1

104

-

Iprscan IPR014746 [G3DSA:3.30.590.10]

105

469

Glutamine synthetase/guanido kinase, catalytic region

Iprscan [PTHR20852]

17

468

-

Iprscan [PTHR20852:SF7]

17

468

-

Iprscan IPR008146 [PF00120]

102

383

Glutamine synthetase, catalytic region

Iprscan IPR008147 [PF03951]

14

95

Glutamine synthetase, beta-Grasp

Iprscan IPR004809 [TIGR00653]

4

468

Glutamine synthetase type I

Iprscan IPR008147 [PS00180]

50

68

Glutamine synthetase, beta-Grasp

Iprscan IPR008146 [PS00181]

259

274

Glutamine synthetase, catalytic region

Iprscan IPR008147 [SSF54368]

2

101

Glutamine synthetase, beta-Grasp

Iprscan [SSF55931]

102

469

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one izlIa70s)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits