Xanthomonas axonopodis pv. citri str. 306

  1. XAC0201adhNP_640557.1alcohol dehydrogenase

adh XAC0201
XAC0200
XAC0200
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC0202
XAC0202
ID adh
AC NP_640557.1
LT XAC0201
SY
OR NC_003919 from 247700 to 248710 on strand +
OS Xanthomonas axonopodis pv. citri str. 306
DE alcohol dehydrogenase
IP Alcohol dehydrogenase superfamily, zinc-containing; NAD(P)-binding
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: binding (GO:0005488)
Molecular Function: catalytic activity (GO:0003824)
PM
AN
SQ 336 aa
 
........10........20........30........40........50
| | | | |
MKAFQIGNQTGLESLVAVEMPEPVAGAGEVIVAPRLVGLINRDLQILKGT
YGGKLAPTRVPVAEGVGIVTCVGAGVGQVVPGDRVVSGHFPTWLDGRFRA
EMFAHDLGVTHDGWLAEKVSLPASALIKVPASLEDADVAALASAAVTAWH
ALVEVARIKAGDLVLCLGTGGVSMAALQLAKLHGARVAITSSSDDKLELA
RRLGADITVNYRTHPDWAEAVMQLSGGGADVVIETGGQDTLGQSIKAAAA
NATIVVVGVTPGAASPIPDYVALIRKNVTIRGIANGSRAMFVDLLRAIEQ
HRIKTLHSKTFRFDEAPQALDYFARAQHVGKVLIRL
xansp

NP_643205.1 lcl|XAC2896-XAC2896

1

336

S=488 I=37 E=1.31488e-52

alcohol dehydrogenase

xansp

NP_641146.1 lcl|XAC0794-XAC0794

152

336

S=160 I=31 E=6.67077e-13

quinone reductase

xansp

NP_640643.1 lcl|XAC0287-XAC0287

100

336

S=138 I=26 E=3.87547e-10

quinone oxidoreductase

xansp

NP_641369.1 lcl|tdh-XAC1022

19

291

S=128 I=27 E=5.78284e-09

L-threonine 3-dehydrogenase

xansp

NP_643135.1 lcl|XAC2826-XAC2826

18

300

S=116 I=26 E=1.67391e-07

alcohol dehydrogenase

xansp

NP_644568.1 lcl|XAC4269-XAC4269

19

101

S=106 I=37 E=2.56394e-06

nuclear receptor binding factor related protein

xansp

NP_644054.1 lcl|ybdR-XAC3747

103

251

S=94 I=27 E=8.09775e-05

Zn-dependent alcohol dehydrogenase

pubmed

1

336

S=447 I=33 E=1.63444e-45

Zinc-binding alcohol dehydrogenase (NADPH:quinone reductase or related Zn-dependent oxidoreductase)

Pubmed 18004300

 

prodomImg

pubmed

161

334

S=291 I=45 E=1.28242e-26

Putative formaldehyde dehydrogenase

Pubmed 15743951,9501423

 

prodomImg

pubmed

1

282

S=245 I=32 E=4.72272e-21

Putative uncharacterized protein

Pubmed 12019272

 

prodomImg

pubmed

19

336

S=241 I=27 E=1.55935e-20

Alcohol dehydrogenase EC=1.1.1.1 ; Metal-binding NAD Oxidoreductase Zinc

Pubmed 1735726,4578954

 

prodomImg

pubmed

15

334

S=234 I=32 E=9.72993e-20

Putative NADPH:quinone oxidoreductase GrhO7

Pubmed 12323376

 

prodomImg

pubmed

13

336

S=232 I=27 E=1.61334e-19

Alcohol dehydrogenase EC=1.1.1.1 ; Metal-binding NAD Oxidoreductase Zinc

Pubmed 8020473

 

prodomImg

pubmed

19

321

S=232 I=30 E=1.62747e-19

6-hydroxycylohex-1-ene-1-carboxyl-CoA dehydrogenase ; Metal-binding Oxidoreductase Zinc

Pubmed 15997700

 

prodomImg

pubmed

14

336

S=230 I=27 E=2.86838e-19

Glucosaminitol dehydrogenase ; Metal-binding Oxidoreductase Zinc

Pubmed 11831851

 

prodomImg

pubmed

19

336

S=228 I=29 E=6.01851e-19

Alcohol dehydrogenase ; Metal-binding Oxidoreductase Zinc

Pubmed 15152088

 

prodomImg

pubmed

13

336

S=227 I=27 E=6.45329e-19

Thermostable alcohol dehydrogenase ; Metal-binding Oxidoreductase Zinc

Pubmed 18436321

 

prodomImg

sp

19

336

S=471 I=37 E=1.09682e-48

Zinc-type alcohol dehydrogenase-like protein C1773.06c - Schizosaccharomyces pombe (Fission yeast)

 

prodomImg

sp

19

336

S=241 I=27 E=9.82005e-21

Alcohol dehydrogenase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 1735726,4578954,436831,8049268,

 

prodomImg

sp

13

336

S=232 I=27 E=1.01601e-19

Alcohol dehydrogenase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 8020473,

 

prodomImg

sp

19

336

S=222 I=27 E=1.698e-18

Alcohol dehydrogenase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 8049268,

 

prodomImg

sp

13

299

S=213 I=28 E=2.10978e-17

Alcohol dehydrogenase - Rhizobium meliloti (Sinorhizobium meliloti)

Pubmed 9659380,11481432,

 

prodomImg

trembl

20

336

S=1470 I=90 E=1.23613e-168

Putative alcohol dehydrogenase - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

154

336

S=827 I=87 E=9.81367e-91

Putative uncharacterized protein XOO4231 - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

154

336

S=827 I=87 E=9.81367e-91

Alcohol dehydrogenase - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Iprscan IPR016040 [G3DSA:3.40.50.720]

123

311

NAD(P)-binding

Iprscan IPR002085 [PTHR11695]

14

336

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan [PTHR11695:SF21]

111

336

-

Iprscan [PTHR11695:SF21]

14

336

-

Iprscan [PTHR11695:SF21]

14

90

-

Iprscan IPR013149 [PF00107]

160

300

Alcohol dehydrogenase, zinc-binding

Iprscan IPR013154 [PF08240]

27

129

Alcohol dehydrogenase GroES-like

Iprscan IPR011032 [SSF50129]

1

177

GroES-like

Iprscan IPR016040 [SSF51735]

133

305

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ReN1AacL)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits