Xanthomonas axonopodis pv. citri str. 306

  1. XAC0011exbD2NP_640367.1biopolymer transport ExbD2 protein

exbD2 XAC0011
XAC0010
XAC0010
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC0012
XAC0012
ID exbD2
AC NP_640367.1
LT XAC0011
SY
OR NC_003919 from 12974 to 13387 on strand +
OS Xanthomonas axonopodis pv. citri str. 306
DE biopolymer transport ExbD2 protein
IP Biopolymer transport protein ExbD/TolR
CL
EC
GO Biological Process: transport (GO:0006810)
Cellular Component: membrane (GO:0016020)
Molecular Function: transporter activity (GO:0005215)
PM
AN
SQ 137 aa
 
........10........20........30........40........50
| | | | |
MAFSTGGSRGPMADINVTPLVDVMLVLLIIFIVTAPIMTYPIAVDLPQRV
LNPPPQTTEPPPPIELRIDASNQVFWNNSPTPVDVLQQKMEEVVQADPTN
QPELRIDANPDAEYEVMAKVLAAAKNSQMKKIGFMQQ
xansp

NP_640366.1 lcl|exbD1-XAC0010

1

135

S=251 I=39 E=2.30779e-24

biopolymer transport ExbD1 protein

xansp

NP_643452.1 lcl|tolR-XAC3144

2

47

S=116 I=54 E=4.26601e-08

TolR protein

pubmed

1

136

S=607 I=89 E=1.59284e-65

Biopolymer transport protein exbD2 ; Cell inner membrane Transmembrane

Pubmed 9371459,18304669

 

prodomImg

pubmed

1

136

S=602 I=88 E=5.44591e-65

ExbD2 ; Protein transport Transmembrane

Pubmed 12646254

 

prodomImg

pubmed

1

135

S=251 I=39 E=1.99606e-22

ExbD1 ; Protein transport Transmembrane

Pubmed 12646254

 

prodomImg

pubmed

1

135

S=251 I=39 E=1.99606e-22

Biopolymer transport protein exbD1 ; Cell inner membrane Transmembrane

Pubmed 9371459,18304669

 

prodomImg

pubmed

1

135

S=233 I=37 E=3.19094e-20

ExbD protein (Biopolymer transport protein ExbD/TolR) ; Transmembrane

Pubmed 10722583

 

prodomImg

pubmed

1

135

S=231 I=36 E=4.93451e-20

ExbD ; Protein transport Transmembrane

Pubmed 10517598

 

prodomImg

pubmed

1

137

S=202 I=36 E=1.54237e-16

ExbD ; Protein transport Transmembrane

Pubmed 14532085

 

prodomImg

pubmed

1

137

S=188 I=34 E=8.66072e-15

Biopolymer transport protein exbD ; Cell inner membrane Transmembrane

Pubmed 9006036

 

prodomImg

pubmed

7

137

S=184 I=35 E=2.55317e-14

Biopolymer transport protein ; Transmembrane

Pubmed 16309397

 

prodomImg

pubmed

1

137

S=182 I=34 E=4.19673e-14

Biopolymer transport protein exbD ; Cell inner membrane Transmembrane

Pubmed 9140974

 

prodomImg

sp

1

136

S=607 I=89 E=1.02683e-65

Biopolymer transport protein exbD2 - Xanthomonas campestris pv. campestris

 

prodomImg

sp

1

136

S=607 I=89 E=1.02683e-65

Biopolymer transport protein exbD2 - Xanthomonas campestris pv. campestris (strain B100)

Pubmed 9371459,18304669,

 

prodomImg

sp

1

135

S=251 I=39 E=1.28677e-22

Biopolymer transport protein exbD1 - Xanthomonas campestris pv. campestris

 

prodomImg

sp

1

135

S=251 I=39 E=1.28677e-22

Biopolymer transport protein exbD1 - Xanthomonas campestris pv. campestris (strain B100)

Pubmed 9371459,18304669,

 

prodomImg

sp

1

137

S=188 I=34 E=5.58317e-15

Biopolymer transport protein exbD - Neisseria meningitidis serogroup C

Pubmed 9006036,

 

prodomImg

trembl

1

137

S=637 I=92 E=1.86358e-68

Biopolymer transport ExbD protein - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

137

S=615 I=89 E=9.49947e-66

Biopolymer transport ExbD2 protein - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

137

S=615 I=89 E=9.49947e-66

Biopolymer transport ExbD2 protein - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Iprscan IPR003400 [PF02472]

8

137

Biopolymer transport protein ExbD/TolR

Iprscan [seg]

53

63

-

Iprscan [SignalP-NN(euk)]

1

39

-

Iprscan [tmhmm]

20

42

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one OT5Q4QpM)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits