Xanthomonas axonopodis pv. citri str. 306

  1. XAC0009exbBNP_640365.1biopolymer transport ExbB protein

exbB XAC0009
XAC0008
XAC0008
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XAC0010
XAC0010
ID exbB
AC NP_640365.1
LT XAC0009
SY
OR NC_003919 from 11740 to 12501 on strand +
OS Xanthomonas axonopodis pv. citri str. 306
DE biopolymer transport ExbB protein
IP MotA/TolQ/ExbB proton channel
CL
EC
GO Biological Process: transport (GO:0006810)
Cellular Component: membrane (GO:0016020)
Molecular Function: protein transporter activity (GO:0008565)
PM
AN
SQ 253 aa
 
........10........20........30........40........50
| | | | |
MLQEFFIAAAAGGSNPSAALSQMGFEHLITEMTSSPGDFAVSWVVLITLI
AMSAASWYWTVINIFRATRLKSAADRVTTAFWDAPNAQDAIRAMEEQPAS
EPFSKIALDAAQAAAHHQRAEGSTGGLGESLSRSEFVDRALRQAVTREST
KLQSGMTLLATVGATAPFVGLLGTVWGIYGALIKIGATGSASIDAVAGPV
GEALIMTAIGLFVAIPAVFAFNFFSKVNSSVIAKFDTFAHDLHDFFATGS
RVR
xansp

NP_643453.1 lcl|tolQ-XAC3145

138

241

S=228 I=48 E=3.09489e-21

TolQ protein

xansp

NP_642406.1 lcl|exbB-XAC2085

151

239

S=137 I=31 E=3.68276e-10

biopolymer transport protein

pubmed

1

253

S=1069 I=85 E=4.01779e-121

ExbB ; Protein transport Transmembrane

Pubmed 12646254

 

prodomImg

pubmed

1

253

S=1069 I=85 E=4.01779e-121

Biopolymer transport protein exbB ; Cell inner membrane Transmembrane

Pubmed 9371459,18304669

 

prodomImg

pubmed

23

252

S=408 I=38 E=5.28015e-41

ExbB protein (MotA/TolQ/ExbB proton channel family protein) ; transport Transmembrane

Pubmed 10722583

 

prodomImg

pubmed

23

252

S=403 I=38 E=2.22546e-40

ExbB ; Protein transport Transmembrane

Pubmed 10517598

 

prodomImg

pubmed

37

250

S=384 I=42 E=4.19865e-38

ExbB ; Protein transport Transmembrane

Pubmed 14532085

 

prodomImg

pubmed

45

243

S=328 I=37 E=3.21348e-31

Biopolymer transport protein exbB ; Cell inner membrane Transmembrane

Pubmed 9140974

 

prodomImg

pubmed

45

243

S=320 I=36 E=2.60457e-30

Biopolymer transport protein exbB ; Cell inner membrane Transmembrane

Pubmed 9006036

 

prodomImg

pubmed

137

245

S=300 I=50 E=6.60948e-28

ExbB (Transport protein ExbB) ; Transmembrane

Pubmed 10689178

 

prodomImg

pubmed

136

242

S=280 I=48 E=2.01426e-25

TolQ protein ; transport Transmembrane

Pubmed 10678921

 

prodomImg

pubmed

136

242

S=280 I=48 E=2.01426e-25

ExbB (Cytoplasmic membrane protein) ; transport Transmembrane

Pubmed 12742718

 

prodomImg

sp

1

253

S=1069 I=85 E=2.53545e-121

Biopolymer transport protein exbB - Xanthomonas campestris pv. campestris

 

prodomImg

sp

1

253

S=1069 I=85 E=2.53545e-121

Biopolymer transport protein exbB - Xanthomonas campestris pv. campestris (strain B100)

Pubmed 9371459,18304669,

 

prodomImg

sp

45

243

S=328 I=37 E=2.02789e-31

Biopolymer transport protein exbB - Neisseria gonorrhoeae

Pubmed 9140974,

 

prodomImg

sp

45

243

S=326 I=37 E=3.24725e-31

Biopolymer transport protein exbB - Neisseria meningitidis serogroup B

 

prodomImg

sp

45

243

S=326 I=37 E=3.24725e-31

Biopolymer transport protein exbB - Neisseria meningitidis serogroup A

 

prodomImg

trembl

1

253

S=1075 I=85 E=5.61037e-121

Biopolymer transport ExbB protein - Xanthomonas campestris pv. vesicatoria (strain 85-10)

 

prodomImg

trembl

1

253

S=1069 I=85 E=2.91502e-120

Biopolymer transport ExbB protein - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

trembl

1

253

S=1069 I=85 E=2.91502e-120

ExbB - Xanthomonas campestris pv. campestris

Pubmed 12646254,

 

prodomImg

Iprscan IPR002898 [PF01618]

100

240

MotA/TolQ/ExbB proton channel

Iprscan [seg]

110

120

-

Iprscan [seg]

121

135

-

Iprscan [seg]

8

19

-

Iprscan [tmhmm]

161

183

-

Iprscan [tmhmm]

203

225

-

Iprscan [tmhmm]

39

61

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one IUFrweQ5)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
xanac

Xanthomonas axonopodis pv. citri str. 306 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits