Sinorhizobium meliloti 1021

  1. SMb21312wgeCCAC49288.1Putative methyltransferase protein WgeC (formerly ExpE3)

wgeC SMb21312
SMb21311
SMb21311
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
Rhizobase ORFeomeORFeome StringString database Multalin
Multalin
SMb21313
SMb21313
ID wgeC
AC CAC49288.1
LT SMb21312
OR AL591985 from 976361 to 977206 on strand -
DE Putative methyltransferase protein WgeC (formerly ExpE3)
IP Methyltransferase type 11
CL III.A.1 surface polysaccharides/antigens
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: methyltransferase activity (GO:0008168)
PM
AN
SQ 281 aa
 
........10........20........30........40........50
| | | | |
MSETALRQENTAATELPARDERVEALLGSILRNRFLPEPNPDSVFVGDGS
FRAVGVEFLGHFILLGGVRPESRVLDIGCGIGRMAVPLTQYLDFEKGHYS
GIDPVEGGIGWCRRFITSVYPNFAFQRVDIAHELYNPSGKISGNALKLPY
ADGHFDFVIMTSIVTHLPPDEVLVYLREVGRLLKPGGRLFMTAFVVDHVA
AANESGRRDARLSFARDGDGPCWYVPDMPRLAAVGFDDGFLDGALDRAGL
AITLKALGAWRGKEAEHYQDIFVAERRGGGA
pubmed

1

281

S=1349 I=93 E=7.12426e-155

ExpE3 (Putative methyltransferase protein WgeC) (Formerly ExpE3) ; Plasmid

Pubmed 9023225

 

prodomImg

pubmed

1

58

S=272 I=91 E=2.22363e-24

Methyltransferase

Pubmed 9501442

 

prodomImg

pubmed

54

192

S=125 I=29 E=1.21074e-06

Arsenic (+3 oxidation state) methyltransferase

Pubmed 12140684

 

prodomImg

pubmed

67

187

S=119 I=31 E=6.57103e-06

Sterol 24-C-methyltransferase EC=2.1.1.41 ; Lipid synthesis S-adenosyl-L-methionine Steroid biosynthesis

Pubmed 9501991

 

prodomImg

pubmed

74

192

S=117 I=29 E=1.25266e-05

Arsenite methyltransferase EC=2.1.1.137 ; Cytoplasm Polymorphism S-adenosyl-L-methionine

Pubmed 16407288

 

prodomImg

pubmed

74

192

S=115 I=29 E=2.00588e-05

Uncharacterized protein AS3MT

Pubmed 15164054

 

prodomImg

pubmed

143

198

S=114 I=43 E=2.86782e-05

Methyltransferase

Pubmed 12619684,12617516

 

prodomImg

pubmed

111

191

S=113 I=35 E=3.41415e-05

Thaxtomin synthetase B ; Ligase Phosphopantetheine

Pubmed 11115114

 

prodomImg

sp

74

220

S=336 I=45 E=2.10808e-32

Uncharacterized protein Rv1498c/MT1546 - Mycobacterium tuberculosis

 

prodomImg

sp

72

192

S=120 I=30 E=3.02736e-06

Arsenite methyltransferase - Mus musculus (Mouse)

 

prodomImg

sp

67

187

S=119 I=31 E=4.14361e-06

Sterol 24-C-methyltransferase - Schizosaccharomyces pombe (Fission yeast)

Pubmed 9501991,

 

prodomImg

sp

74

192

S=117 I=29 E=7.89915e-06

Arsenite methyltransferase - Homo sapiens (Human)

Pubmed 16407288,

 

prodomImg

sp

50

192

S=116 I=28 E=9.40395e-06

Arsenite methyltransferase - Rattus norvegicus (Rat)

Pubmed 11790780,15808521,

 

prodomImg

trembl

1

280

S=1240 I=85 E=6.83272e-141

Methyltransferase type 11 - Sinorhizobium medicae (strain WSM419) (Ensifer medicae)

 

prodomImg

trembl

4

276

S=842 I=58 E=1.20848e-92

Methyltransferase type 11 - Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168)

 

prodomImg

trembl

10

279

S=728 I=53 E=8.8031e-79

Methyltransferase - Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / ORS 571)

 

prodomImg

Iprscan [G3DSA:3.40.50.150]

57

196

-

Iprscan [PTHR10108]

68

196

-

Iprscan [PTHR10108:SF26]

68

196

-

Iprscan IPR013216 [PF08241]

75

191

Methyltransferase type 11

Iprscan [SSF53335]

69

277

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one nwxkx8Gl)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

8 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
trembl

TrEMBL ncbi-blastp

58 hits
trembl

Sinorhizobium meliloti proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits