Sinorhizobium meliloti 1021

  1. SMa0815nifAAAK65101.2NifA transcriptional activator

nifA SMa0815
SMa0814
SMa0814
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
Rhizobase ORFeomeORFeome StringString database Multalin
Multalin
SMa0816
SMa0816
ID nifA
AC AAK65101.2
LT SMa0815
OR AE006469 from 445895 to 447520 on strand -
DE NifA transcriptional activator
IP AAA+ ATPase, core; Nif-specific regulatory protein
CL I.F.6 nitrogen fixation
EC
GO Biological Process: nitrogen fixation (GO:0009399)
Cellular Component: intracellular (GO:0005622)
DNA-dependent (GO:0006355)
Molecular Function: transcription activator activity (GO:0016563)
Molecular Function: transcription factor activity (GO:0003700)
Molecular Function: transcription factor binding (GO:0008134)
Molecular Function: nucleoside-triphosphatase activity (GO:0017111)
Molecular Function: nucleotide binding (GO:0000166)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: ATP binding (GO:0005524)
PM
AN
SQ 541 aa
 
........10........20........30........40........50
| | | | |
MRKQDKRSAEIYSISKALMAPTRLETTLNNFVNTLSLILRMRRGGLEIPA
SEGETKITAATRNSGSPSAADYTVPKAAIDQVMTAGRLVVPDVCNSELFK
DQIKWRGIGPTAFIAAAVEVDHETGGMLWFECAEESDYDYEEEVHFLSMA
ANLAGRAIRLHRTISRRERTFAEEQQEQQNSRDEQSQSSARQRLLKNDGI
IGESTALMTAVDTAKVMAETNSIVLLRGETGTGKECFAKLIHQHSTRQKK
PFIKFNCPALSESLLESELFGHEKGAFTGAIAQRVGRFESANGGTLLLDE
IGEIPPAFQAKLLRVIQEGEFERVGGTKTLKVDVRLIFATNKDLEMAVQN
GEFREDLYYRISGVPLILPPLRHRDGDIPLLARAFLQRFNEENGRDLHFA
PSALDHLSKCKFPGNVRELENCVRRTATLARSKTITSSDFACQTDQCFSS
RLWKGVHCSHGHIEIDAPAGTTPLLGAPANDVPPKEPGSAGVASNLIERD
RLISALEEAGWNQAKAARILEKTPRQVGYALRRHGVDVRKL
rhime CAC47374.1 | tacA

181

440

S=600 I=46 E=8.77664e-66

[lcl|tacA] Putative sigma-54-dependent transcription regulator
rhime CAC46038.1 | ntrC

200

436

S=583 I=48 E=8.17167e-64

[lcl|ntrC] Nitrogen assimilation regulatory protein
rhime CAC49925.1 | dctD

200

427

S=529 I=48 E=3.16832e-57

[lcl|dctD] C4-dicarboxylate transport transcriptional regulatory protein
rhime CAC49265.1 | SMb21200

202

425

S=472 I=44 E=2.38299e-50

[lcl|SMb21200] Putative two-component response regulator
rhime CAC48502.1 | acoR

224

443

S=465 I=46 E=1.67996e-49

[lcl|acoR] Putative acetoin catabolism regulatory protein
rhime CAC46040.1 | ntrX

179

432

S=458 I=40 E=1.42231e-48

[lcl|ntrX] Probable nitrogen regulation protein
pubmed

1

541

S=2835 I=98 E=0

Nif-specific regulatory protein ; Activator ATP-binding DNA-binding Metal-binding Nitrogen fixation Nucleotide-binding Plasmid Transcription re

Pubmed 2989799,11481432

 

prodomImg

pubmed

1

541

S=1492 I=57 E=7.11484e-172

Nif-specific regulatory protein ; Activator ATP-binding DNA-binding Metal-binding Nitrogen fixation Nucleotide-binding Plasmid Transcription reg

Pubmed 8796346

 

prodomImg

pubmed

1

541

S=1396 I=54 E=3.35707e-160

Nif-specific regulatory protein ; Activator ATP-binding DNA-binding Metal-binding Nitrogen fixation Nucleotide-binding Plasmid Transcription r

Pubmed 12801410

 

prodomImg

pubmed

1

541

S=1393 I=54 E=7.29389e-160

Transcriptional activator ; ATP-binding DNA-binding Nucleotide-binding regulation

Pubmed 8042903

 

prodomImg

pubmed

1

540

S=1189 I=50 E=3.77987e-135

NifA regulatory protein ; ATP-binding DNA-binding Nucleotide-binding Transcription regulation

Pubmed 2693897

 

prodomImg

pubmed

1

540

S=1182 I=50 E=2.85724e-134

Transcriptional activator of nitrogen fixation genes ; ATP-binding DNA-binding Nucleotide-binding regulation

Pubmed 15375140

 

prodomImg

pubmed

1

540

S=1182 I=50 E=2.85724e-134

Nif-specific regulatory protein ; Activator ATP-binding DNA-binding Metal-binding Nitrogen fixation Nucleotide-binding Plasmid Transcription regulation

Pubmed 3029674

 

prodomImg

pubmed

9

541

S=1169 I=46 E=8.56413e-133

Nif-specific regulatory protein ; Activator ATP-binding DNA-binding Metal-binding Nitrogen fixation Nucleotide-binding Transcription regulation

Pubmed 3313281

 

prodomImg

pubmed

11

455

S=1108 I=52 E=2.16422e-125

Nif-specific regulatory protein ; Activator ATP-binding DNA-binding Metal-binding Nitrogen fixation Nucleotide-binding Transcription regulation

Pubmed 2664425,3186446

 

prodomImg

pubmed

498

541

S=147 I=55 E=5.84176e-09

Nif-specific regulatory protein ; Activator ATP-binding DNA-binding Metal-binding Nitrogen fixation Nucleotide-binding Transcription regulation

Pubmed 2664425,3186446

 

prodomImg

sp

1

541

S=1492 I=57 E=4.51059e-172

Nif-specific regulatory protein - Rhizobium sp. (strain NGR234)

Pubmed 8796346,

 

prodomImg

sp

1

541

S=1396 I=54 E=2.12828e-160

Nif-specific regulatory protein - Rhizobium etli (strain CFN 42 / ATCC 51251)

Pubmed 12801410,

 

prodomImg

sp

1

540

S=1182 I=50 E=1.8114e-134

Nif-specific regulatory protein - Rhizobium leguminosarum

Pubmed 3029674,

 

prodomImg

sp

9

541

S=1169 I=46 E=5.4294e-133

Nif-specific regulatory protein - Bradyrhizobium japonicum

Pubmed 3313281,3357773,2792368,

 

prodomImg

sp

11

455

S=1108 I=52 E=1.37205e-125

Nif-specific regulatory protein - Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / ORS 571)

Pubmed 2664425,3186446,

 

prodomImg

trembl

1

541

S=2590 I=89 E=0

Transcriptional regulator, NifA, Fis Family - Sinorhizobium medicae (strain WSM419) (Ensifer medicae)

 

prodomImg

trembl

2

541

S=1480 I=56 E=1.65129e-169

Nif-specific regulatory protein; NifA - Rhizobium loti (Mesorhizobium loti)

 

prodomImg

trembl

2

541

S=1470 I=56 E=2.73577e-168

PROBABLE NIF-SPECIFIC REGULATORY PROTEIN ACTIVATOR ATP-BINDING, DNA-BINDING NIFA - Rhizobium loti (Mesorhizobium loti)

 

prodomImg

Iprscan IPR002197 [PR01590]

500

517

Helix-turn-helix, Fis-type

Iprscan IPR002197 [PR01590]

517

537

Helix-turn-helix, Fis-type

Iprscan [G3DSA:1.10.8.60]

373

447

-

Iprscan [G3DSA:3.40.50.300]

198

372

-

Iprscan IPR002078 [PF00158]

200

420

RNA polymerase sigma factor 54, interaction

Iprscan IPR003018 [PF01590]

23

158

GAF

Iprscan IPR002197 [PF02954]

497

534

Helix-turn-helix, Fis-type

Iprscan IPR003018 [SM00065]

23

168

GAF

Iprscan IPR003593 [SM00382]

220

363

AAA+ ATPase, core

Iprscan IPR010113 [TIGR01817]

5

541

Nif-specific regulatory protein

Iprscan IPR002078 [PS00675]

224

237

RNA polymerase sigma factor 54, interaction

Iprscan IPR002078 [PS00676]

286

301

RNA polymerase sigma factor 54, interaction

Iprscan IPR002078 [PS00688]

412

421

RNA polymerase sigma factor 54, interaction

Iprscan IPR002078 [PS50045]

200

428

RNA polymerase sigma factor 54, interaction

Iprscan IPR009057 [SSF46689]

412

537

Homeodomain-like

Iprscan [SSF52540]

199

440

-

Iprscan [SSF55781]

4

189

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one qc3EqwP9)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

291 hits
swiss-prot

Swiss-Prot ncbi-blastp

127 hits
trembl

TrEMBL ncbi-blastp

6277 hits
trembl

Sinorhizobium meliloti proteome ncbi-blastp

7 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

17 hits